BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_G19 (883 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g26860.2 68415.m03223 F-box family protein contains F-box dom... 32 0.58 At2g26860.1 68415.m03222 F-box family protein contains F-box dom... 32 0.58 At1g64255.1 68414.m07280 SWIM zinc finger family protein contain... 31 1.3 At3g61680.1 68416.m06912 lipase class 3 family protein contains ... 29 5.4 >At2g26860.2 68415.m03223 F-box family protein contains F-box domain Pfam:PF00646 Length = 355 Score = 31.9 bits (69), Expect = 0.58 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = -1 Query: 619 LIFKYWLYLVLWILKYTLLFSHQGNELPTDEF 524 ++ K W +L LW+ K T + +H ++LP +F Sbjct: 29 ILSKRWEFLWLWVPKLTFVMNHYESDLPIQDF 60 >At2g26860.1 68415.m03222 F-box family protein contains F-box domain Pfam:PF00646 Length = 405 Score = 31.9 bits (69), Expect = 0.58 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = -1 Query: 619 LIFKYWLYLVLWILKYTLLFSHQGNELPTDEF 524 ++ K W +L LW+ K T + +H ++LP +F Sbjct: 29 ILSKRWEFLWLWVPKLTFVMNHYESDLPIQDF 60 >At1g64255.1 68414.m07280 SWIM zinc finger family protein contains Pfam profile PF04434: SWIM zinc finger Length = 750 Score = 30.7 bits (66), Expect = 1.3 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +3 Query: 294 LIIDKXRNTMEYCYKLWVGNGQEIVRKYFPLNF 392 +++D EY KL + +G + KYFPL F Sbjct: 386 IVVDTKNLNCEYQLKLMIASGVDAANKYFPLAF 418 >At3g61680.1 68416.m06912 lipase class 3 family protein contains Pfam profile PF01764: Lipase Length = 649 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +1 Query: 634 NCNSRXRVVYGGNSADSTREQWFFQPAKYENXVLFLH 744 N +R V+ G +S S + FF+P K+E+ + +H Sbjct: 349 NTYTRCFVIQGSDSLASWKANLFFEPTKFEDTDVLVH 385 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,057,180 Number of Sequences: 28952 Number of extensions: 261733 Number of successful extensions: 641 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 623 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 641 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 2077687200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -