BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_G10 (894 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L04753-1|AAA29357.1| 511|Anopheles gambiae alpha-amylase protein. 24 7.2 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 24 7.2 >L04753-1|AAA29357.1| 511|Anopheles gambiae alpha-amylase protein. Length = 511 Score = 23.8 bits (49), Expect = 7.2 Identities = 10/32 (31%), Positives = 15/32 (46%) Frame = -3 Query: 421 MKAHNSARSFGRCRLEQWVFRFWRLWHILEKR 326 M +H R+FG +W+ F W +L R Sbjct: 277 MFSHYLGRAFGGNDALRWLSNFGEAWRLLASR 308 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 23.8 bits (49), Expect = 7.2 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = +3 Query: 213 RKISLQTLTIRSELVLYGPVESVTQTTH 296 +KISL+ ++ + + VE++ TTH Sbjct: 1425 KKISLRKAEVKQRIGSWNYVETIVDTTH 1452 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 906,360 Number of Sequences: 2352 Number of extensions: 20164 Number of successful extensions: 34 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 34 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 96334083 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -