BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_G08 (936 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0507 + 3655570-3655573,3655648-3655832 82 5e-16 10_08_1008 - 22222051-22222377,22222479-22222640,22223179-222233... 30 2.3 >06_01_0507 + 3655570-3655573,3655648-3655832 Length = 62 Score = 82.2 bits (194), Expect = 5e-16 Identities = 38/59 (64%), Positives = 44/59 (74%) Frame = +1 Query: 298 GKVHGSLARAGKVKGQTPKVEXXXXXXXXTGRAKRRIQYNRRFVNVVQTFGRRRGPNSN 474 GKVHGSLARAGKV+GQTPKV GRA +R+QYNRRFV V FG++RGPNS+ Sbjct: 2 GKVHGSLARAGKVRGQTPKVAKQDKKKKPRGRAHKRMQYNRRFVTAVVGFGKKRGPNSS 60 >10_08_1008 - 22222051-22222377,22222479-22222640,22223179-22223310, 22224556-22224608,22224713-22225256 Length = 405 Score = 30.3 bits (65), Expect = 2.3 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = -2 Query: 311 PCTLPPSNGTVRASSDDESSETRHEAXKGAPHN 213 P PPS GT SSDD S H G P+N Sbjct: 334 PVASPPSEGTSSGSSDDSGSPINH---SGMPYN 363 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,875,104 Number of Sequences: 37544 Number of extensions: 122735 Number of successful extensions: 338 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 336 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 338 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2682675460 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -