BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_G08 (936 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U53148-5|AAB37076.1| 130|Caenorhabditis elegans Ribosomal prote... 87 2e-17 AF000194-3|AAK39379.1| 191|Caenorhabditis elegans Hypothetical ... 29 6.3 >U53148-5|AAB37076.1| 130|Caenorhabditis elegans Ribosomal protein, small subunitprotein 30 protein. Length = 130 Score = 87.0 bits (206), Expect = 2e-17 Identities = 41/63 (65%), Positives = 47/63 (74%) Frame = +1 Query: 289 LLGGKVHGSLARAGKVKGQTPKVEXXXXXXXXTGRAKRRIQYNRRFVNVVQTFGRRRGPN 468 LLGGKVHGSLARAGKV+ QTPKV+ GRA RR+QY RR+VNV G++RGPN Sbjct: 68 LLGGKVHGSLARAGKVRAQTPKVDKQDKKKKKRGRAFRRVQYTRRYVNVASGPGKKRGPN 127 Query: 469 SNS 477 SNS Sbjct: 128 SNS 130 >AF000194-3|AAK39379.1| 191|Caenorhabditis elegans Hypothetical protein ZC328.5 protein. Length = 191 Score = 28.7 bits (61), Expect = 6.3 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = -2 Query: 329 PARAKDPCTLPPSNGTVRASSDDES 255 P RAK P T PPS TV +S+ +S Sbjct: 24 PCRAKRPTTEPPSTTTVESSTTRDS 48 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,368,977 Number of Sequences: 27780 Number of extensions: 105994 Number of successful extensions: 249 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 238 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 249 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2412704140 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -