BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_G07 (904 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0088 - 698169-698614,699514-700819,703041-703148 29 6.7 01_02_0026 - 10314159-10314413,10315263-10315341,10316347-10316585 29 6.7 >12_01_0088 - 698169-698614,699514-700819,703041-703148 Length = 619 Score = 28.7 bits (61), Expect = 6.7 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = -2 Query: 252 AXHXLNFLEELPPGLGSSADRAESQHQREDEAQNTYKXHF 133 A H + F + P GSS+ + SQH+R ++ +K H+ Sbjct: 580 AVHDIGFRD--PTTYGSSSSSSSSQHRRRSSSKVDHKHHY 617 >01_02_0026 - 10314159-10314413,10315263-10315341,10316347-10316585 Length = 190 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = -3 Query: 272 INPSRTXRPTXSIFLKSFHLGS 207 + SR +PT ++FLK+FHL S Sbjct: 74 LRSSRGGKPTPTLFLKNFHLAS 95 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,703,962 Number of Sequences: 37544 Number of extensions: 211953 Number of successful extensions: 348 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 344 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 348 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2553813320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -