BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_G07 (904 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY051978-1|AAK93402.1| 1412|Drosophila melanogaster LD44770p pro... 29 6.6 AE014134-2038|AAF53077.1| 1412|Drosophila melanogaster CG4751-PA... 29 6.6 >AY051978-1|AAK93402.1| 1412|Drosophila melanogaster LD44770p protein. Length = 1412 Score = 29.5 bits (63), Expect = 6.6 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = -1 Query: 721 YTQKKKNENLNFLNIHSNK-TYNVKLKDELY 632 Y + ++E + F NI++N TYN KLK+ LY Sbjct: 462 YYSQYRSEMVKFRNIYNNDVTYNEKLKNTLY 492 >AE014134-2038|AAF53077.1| 1412|Drosophila melanogaster CG4751-PA protein. Length = 1412 Score = 29.5 bits (63), Expect = 6.6 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = -1 Query: 721 YTQKKKNENLNFLNIHSNK-TYNVKLKDELY 632 Y + ++E + F NI++N TYN KLK+ LY Sbjct: 462 YYSQYRSEMVKFRNIYNNDVTYNEKLKNTLY 492 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,415,489 Number of Sequences: 53049 Number of extensions: 383963 Number of successful extensions: 629 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 627 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 629 length of database: 24,988,368 effective HSP length: 85 effective length of database: 20,479,203 effective search space used: 4403028645 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -