BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_G06 (904 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC017329-1|AAH17329.1| 481|Homo sapiens HIV-1 Rev binding prote... 31 5.7 AF053356-14|AAC78803.1| 318|Homo sapiens nucleoporin protein. 31 5.7 AF015042-1|AAD01550.1| 481|Homo sapiens RAB-R protein protein. 31 5.7 >BC017329-1|AAH17329.1| 481|Homo sapiens HIV-1 Rev binding protein-like protein. Length = 481 Score = 31.1 bits (67), Expect = 5.7 Identities = 15/48 (31%), Positives = 27/48 (56%) Frame = +2 Query: 74 HEVCLNSWLGL*PSRSAVQYQSRAP*RQKMWMPYLLKSKRKFCPSSKM 217 +EVC WLGL +R+++ SR P + K ++ + KR + P ++ Sbjct: 104 NEVCRKIWLGLFDARTSLVPDSRDPQKVKEFLQEKYEKKRWYVPPDQV 151 >AF053356-14|AAC78803.1| 318|Homo sapiens nucleoporin protein. Length = 318 Score = 31.1 bits (67), Expect = 5.7 Identities = 15/48 (31%), Positives = 27/48 (56%) Frame = +2 Query: 74 HEVCLNSWLGL*PSRSAVQYQSRAP*RQKMWMPYLLKSKRKFCPSSKM 217 +EVC WLGL +R+++ SR P + K ++ + KR + P ++ Sbjct: 30 NEVCRKIWLGLFDARTSLVPDSRDPQKVKEFLQEKYEKKRWYVPPDQV 77 >AF015042-1|AAD01550.1| 481|Homo sapiens RAB-R protein protein. Length = 481 Score = 31.1 bits (67), Expect = 5.7 Identities = 15/48 (31%), Positives = 27/48 (56%) Frame = +2 Query: 74 HEVCLNSWLGL*PSRSAVQYQSRAP*RQKMWMPYLLKSKRKFCPSSKM 217 +EVC WLGL +R+++ SR P + K ++ + KR + P ++ Sbjct: 104 NEVCRKIWLGLFDARTSLVPNSRDPQKVKEFLQEKYEKKRWYVPPDQV 151 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 117,027,581 Number of Sequences: 237096 Number of extensions: 2366074 Number of successful extensions: 4303 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4182 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4303 length of database: 76,859,062 effective HSP length: 90 effective length of database: 55,520,422 effective search space used: 11659288620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -