BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_G05 (887 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1235.05c |fft2||fun thirty related protein Fft2|Schizosaccha... 26 6.2 SPAC1F3.01 |rrp6|SPAC3H8.11|exosome subunit Rrp6 |Schizosaccharo... 26 8.2 SPAC6G10.05c |||TRAPP complex subunit Trs120 |Schizosaccharomyce... 26 8.2 SPCC895.06 |||RNA polymerase II elongator complex subunit Elp2 |... 26 8.2 >SPCC1235.05c |fft2||fun thirty related protein Fft2|Schizosaccharomyces pombe|chr 3|||Manual Length = 1284 Score = 26.2 bits (55), Expect = 6.2 Identities = 13/40 (32%), Positives = 23/40 (57%), Gaps = 2/40 (5%) Frame = +2 Query: 107 PSLSVAPYLNSKQHRLTLRSS--KSKXRFCLFSTTLTRST 220 PSL V PY S+Q R +R + +++ ++ + TT +T Sbjct: 622 PSLRVEPYYGSQQERANIREAIEENEIKYDILVTTYQLAT 661 >SPAC1F3.01 |rrp6|SPAC3H8.11|exosome subunit Rrp6 |Schizosaccharomyces pombe|chr 1|||Manual Length = 777 Score = 25.8 bits (54), Expect = 8.2 Identities = 16/54 (29%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = -3 Query: 327 DLVHH-HEIFVGFHVCVAVLAGLDVEVLGDFVVLSFIVDLVNVVEKRQNLLLLF 169 DL HH + F GF VC+ ++ + + + D + L ++ +NVV N++ +F Sbjct: 243 DLEHHDYRSFRGF-VCLMQISNREKDWIVDTLELREELEALNVVFTNPNIIKVF 295 >SPAC6G10.05c |||TRAPP complex subunit Trs120 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1210 Score = 25.8 bits (54), Expect = 8.2 Identities = 13/47 (27%), Positives = 23/47 (48%), Gaps = 3/47 (6%) Frame = -3 Query: 417 GIIEQLEQRXGFXPHFFVKD---REFQILGKESDLVHHHEIFVGFHV 286 G + +E F++K+ +E Q K D +HH EI++ H+ Sbjct: 1029 GFKKSIEDSYTMKKRFWIKEYFLKEVQASWKTDDNLHHGEIYLRNHI 1075 >SPCC895.06 |||RNA polymerase II elongator complex subunit Elp2 |Schizosaccharomyces pombe|chr 3|||Manual Length = 760 Score = 25.8 bits (54), Expect = 8.2 Identities = 6/15 (40%), Positives = 10/15 (66%) Frame = -2 Query: 733 CLRXWGKSGNWNSWR 689 C+ WG++G W W+ Sbjct: 340 CVVCWGRTGGWRLWK 354 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,050,871 Number of Sequences: 5004 Number of extensions: 57141 Number of successful extensions: 187 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 182 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 187 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 446488370 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -