BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_G04 (889 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1235.01 ||SPCC320.02c|sequence orphan|Schizosaccharomyces po... 29 0.88 SPBC21D10.06c |map4||cell agglutination protein Map4|Schizosacch... 29 1.2 SPCC622.15c |||sequence orphan|Schizosaccharomyces pombe|chr 3||... 28 1.5 SPAC4F10.16c |||P-type ATPase |Schizosaccharomyces pombe|chr 1||... 27 3.6 SPBC1685.01 |pmp1||dual-specificity MAP kinase phosphatase Pmp1|... 27 4.7 SPAC9G1.02 |wis4|wak1, wik1|MAP kinase kinase kinase Wis4|Schizo... 27 4.7 SPAC29B12.10c |||OPT oligopeptide transporter family|Schizosacch... 26 8.2 >SPCC1235.01 ||SPCC320.02c|sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 658 Score = 29.1 bits (62), Expect = 0.88 Identities = 16/55 (29%), Positives = 29/55 (52%) Frame = +2 Query: 101 PTLKETATNLLTTARTSLILPKTTTLMETATNLSTTVHITWTLPKADLTSSLPLS 265 PT++ T T ++ T T + +TTT+ + T + T T P + T+ LP++ Sbjct: 102 PTVETTTTPMVETT-TITPMVETTTITPMVEAMITLMEETMTTPMEETTTILPMA 155 >SPBC21D10.06c |map4||cell agglutination protein Map4|Schizosaccharomyces pombe|chr 2|||Manual Length = 948 Score = 28.7 bits (61), Expect = 1.2 Identities = 16/50 (32%), Positives = 29/50 (58%) Frame = +2 Query: 119 ATNLLTTARTSLILPKTTTLMETATNLSTTVHITWTLPKADLTSSLPLSL 268 A+ L +++ T+ + P +T ET ++ S+ T T+ + TSS P+SL Sbjct: 234 ASTLESSSLTNTVSPTESTFYETKSSTSSVP--TQTIDSSSFTSSTPVSL 281 >SPCC622.15c |||sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 557 Score = 28.3 bits (60), Expect = 1.5 Identities = 16/39 (41%), Positives = 19/39 (48%), Gaps = 4/39 (10%) Frame = +1 Query: 166 DYNPNG-NGYEPIDNGAYYVDPPQG---RPYFKPTPFPG 270 DYN N N Y PI N Y+++ G PYF PG Sbjct: 119 DYNNNRKNFYPPIQNSTYFINATGGIDSMPYFGLNNAPG 157 >SPAC4F10.16c |||P-type ATPase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1367 Score = 27.1 bits (57), Expect = 3.6 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = -2 Query: 288 LLPTASTRERGRLEVRSALGRVHVICTVVDRFV 190 ++P STR+R + +R G +H+IC D + Sbjct: 762 IIPFTSTRKRMSVIIRDEDGIIHLICKGADTVI 794 >SPBC1685.01 |pmp1||dual-specificity MAP kinase phosphatase Pmp1|Schizosaccharomyces pombe|chr 2|||Manual Length = 278 Score = 26.6 bits (56), Expect = 4.7 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +1 Query: 160 PKDYNPNGNGYEPIDNGAYYVDPPQGRPYFKPT 258 PK PN N +P NG + PP Y KPT Sbjct: 46 PKASKPNSN--QPYPNGPVCIYPPNIYLYAKPT 76 >SPAC9G1.02 |wis4|wak1, wik1|MAP kinase kinase kinase Wis4|Schizosaccharomyces pombe|chr 1|||Manual Length = 1401 Score = 26.6 bits (56), Expect = 4.7 Identities = 10/36 (27%), Positives = 17/36 (47%) Frame = +3 Query: 192 RTYRQRCILRGPSPRPTLLQAYPFPWCSRWEVKNIL 299 R + ++C R P RP + PW + + K I+ Sbjct: 1280 RDFIEQCFERDPEQRPRAVDLLTHPWITDFRKKTII 1315 >SPAC29B12.10c |||OPT oligopeptide transporter family|Schizosaccharomyces pombe|chr 1|||Manual Length = 851 Score = 25.8 bits (54), Expect = 8.2 Identities = 15/49 (30%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +2 Query: 86 LCWLWPTLKETATNLLTTARTSL-ILPKTTTLMETATNLSTTVHITWTL 229 LCW+WP K N L + L ILP T + N + W + Sbjct: 361 LCWIWP--KNRVVNQLFGYNSGLGILPLTFDWQQVVYNSNPLASPWWVI 407 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,692,590 Number of Sequences: 5004 Number of extensions: 46301 Number of successful extensions: 142 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 133 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 142 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 446488370 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -