BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_F24 (900 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_53353| Best HMM Match : Vicilin_N (HMM E-Value=8.3) 72 6e-13 >SB_53353| Best HMM Match : Vicilin_N (HMM E-Value=8.3) Length = 171 Score = 72.1 bits (169), Expect = 6e-13 Identities = 44/119 (36%), Positives = 62/119 (52%), Gaps = 2/119 (1%) Frame = +2 Query: 395 LEKNARXLKPIDX--LEVPLHLMDSLKKYKRPPVQLSVEEIEARELLQKEWARYKRDXYM 568 + K + + PID L P +L + ++ K V+LS EE E R LL KEW+RYK + Sbjct: 46 IRKPSEIVPPIDPDSLLNPAYLESNRQRAK---VKLSEEEEEERILLLKEWSRYKMQQHK 102 Query: 569 NNXAQVDRIXAAQRRALDRLYEESEDLYNEAIMPDLPLLPYTISGPVATPPIKDYESPD 745 + ++ + AL L + SE LY EAI D L P + GP TPP+ Y +PD Sbjct: 103 EDLQRLQEQARCREEALKELKKTSEFLYKEAIKADKTLFPLQLRGPTHTPPLTGYIAPD 161 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,434,193 Number of Sequences: 59808 Number of extensions: 270237 Number of successful extensions: 590 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 498 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 589 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2586032617 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -