BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_F24 (900 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g27325.1 68416.m03415 expressed protein 30 1.8 At4g05400.1 68417.m00822 expressed protein 28 7.3 >At3g27325.1 68416.m03415 expressed protein Length = 1048 Score = 30.3 bits (65), Expect = 1.8 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 626 LYEESEDLYNEAIMPDLPLLPYTISGPVATPPIKDYESPDGEYXDVSK 769 L E+ YN + L LLP T+S IK + PDGE D+ K Sbjct: 595 LKEDHPLAYNLSFSTSLGLLPATLSLKTTGCGIKTFGLPDGETGDLDK 642 >At4g05400.1 68417.m00822 expressed protein Length = 250 Score = 28.3 bits (60), Expect = 7.3 Identities = 20/74 (27%), Positives = 32/74 (43%) Frame = +2 Query: 512 EARELLQKEWARYKRDXYMNNXAQVDRIXAAQRRALDRLYEESEDLYNEAIMPDLPLLPY 691 E E L KE+++ + A + ++ A++ L E+L A+ PDL P Sbjct: 162 EDGERLAKEYSKVLMREHRERRAAETALLNLKKSAIEAL---PENLKKAALEPDLTPFPA 218 Query: 692 TISGPVATPPIKDY 733 TPPI+ Y Sbjct: 219 NRGMATLTPPIEGY 232 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,245,226 Number of Sequences: 28952 Number of extensions: 194681 Number of successful extensions: 444 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 437 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 444 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2120147664 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -