BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_F21 (919 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBPB2B2.09c |||2-dehydropantoate 2-reductase |Schizosaccharomyc... 29 0.92 SPAC12G12.01c ||SPAC630.02|ubiquitin-protein ligase E3|Schizosac... 27 3.7 >SPBPB2B2.09c |||2-dehydropantoate 2-reductase |Schizosaccharomyces pombe|chr 2|||Manual Length = 350 Score = 29.1 bits (62), Expect = 0.92 Identities = 16/37 (43%), Positives = 22/37 (59%) Frame = +2 Query: 524 VSWKLIALWENNKVYFKILNTERNQYLVLGVGTNWNG 634 + +K I L++NN+ KILN R V+ VGT NG Sbjct: 254 IFFKCIPLFKNNEEAEKILNVNRLLDRVMFVGTKVNG 290 >SPAC12G12.01c ||SPAC630.02|ubiquitin-protein ligase E3|Schizosaccharomyces pombe|chr 1|||Manual Length = 905 Score = 27.1 bits (57), Expect = 3.7 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +2 Query: 509 KTSPRVSWKLIALWENNKVYFKILNTERNQYLVLGVGTN 625 K SP+V+WK +W + K K +++ +LG G++ Sbjct: 28 KASPKVNWKTHIIWRSLK-NVKCIDSFHGNNEILGAGSS 65 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,943,075 Number of Sequences: 5004 Number of extensions: 51093 Number of successful extensions: 154 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 149 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 154 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 466510270 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -