BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_F21 (919 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein ... 25 3.2 AY705400-1|AAU12509.1| 490|Anopheles gambiae nicotinic acetylch... 23 9.8 AY341206-1|AAR13770.1| 196|Anopheles gambiae SP14D1 protein. 23 9.8 >AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein protein. Length = 596 Score = 25.0 bits (52), Expect = 3.2 Identities = 17/53 (32%), Positives = 25/53 (47%) Frame = +2 Query: 461 DVQGDDGRPAYGDGKDKTSPRVSWKLIALWENNKVYFKILNTERNQYLVLGVG 619 D GD GRPAY D + +V + ++Y L TE ++ L+ G G Sbjct: 101 DRNGDGGRPAYSGNSDPSMDQVKTD-----KPRELYIPPLPTE-DESLIFGSG 147 >AY705400-1|AAU12509.1| 490|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 6 protein. Length = 490 Score = 23.4 bits (48), Expect = 9.8 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -1 Query: 535 LPADSRACLVLAVAVGRSAIVALNIIAQ 452 LP DS L L V + S V LN++A+ Sbjct: 255 LPPDSGEKLTLGVTILLSLTVFLNLVAE 282 >AY341206-1|AAR13770.1| 196|Anopheles gambiae SP14D1 protein. Length = 196 Score = 23.4 bits (48), Expect = 9.8 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +2 Query: 689 LQPAKYDNDVLFYIYNREYSKALTLSRTVXP 781 LQ + ND+ +NRE + + T+S P Sbjct: 41 LQDKSHHNDIALIRFNREINYSSTISAICLP 71 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 749,869 Number of Sequences: 2352 Number of extensions: 13464 Number of successful extensions: 74 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 74 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 74 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 99641691 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -