BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_F21 (919 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U13019-4|AAC24451.1| 222|Caenorhabditis elegans Hypothetical pr... 29 4.7 U13019-3|AAC24452.2| 713|Caenorhabditis elegans Hypothetical pr... 29 4.7 Z75529-3|CAA99786.2| 1099|Caenorhabditis elegans Hypothetical pr... 28 8.1 >U13019-4|AAC24451.1| 222|Caenorhabditis elegans Hypothetical protein T12A2.15b protein. Length = 222 Score = 29.1 bits (62), Expect = 4.7 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = +2 Query: 497 DGKDKTSPRVSWKLIALWENNKVYFKILNTERN 595 D KD+ +P VS KL+AL N +V+ K T +N Sbjct: 120 DKKDQCNPYVSVKLVALDGNKEVFKKKTPTAKN 152 >U13019-3|AAC24452.2| 713|Caenorhabditis elegans Hypothetical protein T12A2.15a protein. Length = 713 Score = 29.1 bits (62), Expect = 4.7 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = +2 Query: 497 DGKDKTSPRVSWKLIALWENNKVYFKILNTERN 595 D KD+ +P VS KL+AL N +V+ K T +N Sbjct: 611 DKKDQCNPYVSVKLVALDGNKEVFKKKTPTAKN 643 >Z75529-3|CAA99786.2| 1099|Caenorhabditis elegans Hypothetical protein C44H9.4 protein. Length = 1099 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/54 (24%), Positives = 29/54 (53%), Gaps = 3/54 (5%) Frame = +2 Query: 488 AYGDGKDKTSPRVSWKLIALWENNK---VYFKILNTERNQYLVLGVGTNWNGDH 640 ++G + PR ++ I+ + + YF++L+ E N+Y+++ N +G H Sbjct: 129 SWGPNFNSPKPRQVFRDISTYSYERGIRAYFRVLSAEDNKYILIACHANLHGLH 182 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,329,409 Number of Sequences: 27780 Number of extensions: 285834 Number of successful extensions: 674 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 665 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 674 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2349764032 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -