BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_F19 (893 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0459 + 18092656-18092724,18092827-18092886,18092970-180930... 29 3.8 03_01_0300 + 2350232-2352274,2352349-2352669,2352752-2352838,235... 29 3.8 >10_08_0459 + 18092656-18092724,18092827-18092886,18092970-18093038, 18093134-18093178,18093706-18094332,18094424-18094597, 18094688-18094991,18095070-18095161,18095253-18095319, 18095407-18095478,18095613-18095830,18095979-18096113, 18096225-18096520,18096603-18096774,18096860-18096958, 18097048-18097179,18097273-18097373,18097460-18097649, 18097713-18097751 Length = 986 Score = 29.5 bits (63), Expect = 3.8 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = -3 Query: 834 VRDFRLLCXFIPRPCGDRR 778 +RDF+ C F P+PC +RR Sbjct: 338 LRDFKSTCYFQPQPCDERR 356 >03_01_0300 + 2350232-2352274,2352349-2352669,2352752-2352838, 2353031-2353708,2353800-2353964,2354139-2354433, 2354581-2354795,2354885-2355190,2355269-2355332, 2355426-2355665,2355783-2355886 Length = 1505 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/53 (24%), Positives = 27/53 (50%) Frame = +3 Query: 57 LGHTQASPLQSCSPLSFFSVFSWHLCMLQLPTSLTXFWRXSFTIASSSPITXV 215 LG ++ +Q ++ S +W + +L +P ++ W + IASS +T + Sbjct: 1059 LGGFASTTIQLLGIVAVMSKVTWQVLILIVPMAVACMWMQRYYIASSRELTRI 1111 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,827,265 Number of Sequences: 37544 Number of extensions: 377685 Number of successful extensions: 935 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 923 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 935 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2518669100 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -