BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_F19 (893 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein ... 24 7.2 AY341206-1|AAR13770.1| 196|Anopheles gambiae SP14D1 protein. 23 9.5 >AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein protein. Length = 596 Score = 23.8 bits (49), Expect = 7.2 Identities = 16/50 (32%), Positives = 24/50 (48%) Frame = +3 Query: 468 GDDGRPAYGDGKDKTSPRVSWKLIALWENNKVYFKILNTERNQYLVLGVG 617 GD GRPAY D + +V + ++Y L TE ++ L+ G G Sbjct: 104 GDGGRPAYSGNSDPSMDQVKTD-----KPRELYIPPLPTE-DESLIFGSG 147 >AY341206-1|AAR13770.1| 196|Anopheles gambiae SP14D1 protein. Length = 196 Score = 23.4 bits (48), Expect = 9.5 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +3 Query: 687 LQPAKYDNDVLFYIYNREYSKALTLSRTVXP 779 LQ + ND+ +NRE + + T+S P Sbjct: 41 LQDKSHHNDIALIRFNREINYSSTISAICLP 71 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 774,506 Number of Sequences: 2352 Number of extensions: 13222 Number of successful extensions: 121 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 121 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 121 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 96334083 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -