BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_F17 (900 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ182013-1|ABA56305.1| 75|Anopheles gambiae G(alpha)c protein. 26 1.4 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 24 7.2 AJ304412-1|CAC39105.1| 196|Anopheles gambiae dynamin protein. 23 9.6 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 23 9.6 AF080563-1|AAC31943.1| 310|Anopheles gambiae Ultrabithorax home... 23 9.6 AF080562-1|AAC31942.1| 327|Anopheles gambiae Ultrabithorax home... 23 9.6 >DQ182013-1|ABA56305.1| 75|Anopheles gambiae G(alpha)c protein. Length = 75 Score = 26.2 bits (55), Expect = 1.4 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +1 Query: 637 YIDEFGQTTTRMQ*KKCFICEIXDAIALXVT 729 ++D GQ T R + KCF C + + L T Sbjct: 13 FVDVGGQRTQRQKWTKCFDCSVTSILFLVST 43 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 23.8 bits (49), Expect = 7.2 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = -1 Query: 717 SNSITNFTNKAFFSLHS 667 SN+I NFT KAF L S Sbjct: 520 SNNIENFTRKAFKDLPS 536 >AJ304412-1|CAC39105.1| 196|Anopheles gambiae dynamin protein. Length = 196 Score = 23.4 bits (48), Expect = 9.6 Identities = 11/51 (21%), Positives = 23/51 (45%) Frame = +2 Query: 131 TRKFMTNRLLARKQMVCDVLHPGKPTVSKTEIREKLAKMYKVTPDVVFVFG 283 T+ F+ LLA D + + + + RE++ +MY + + + G Sbjct: 132 TKDFINGELLAHLYATGDQASMMEESADEAQKREEMLRMYHACKEALRIIG 182 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 23.4 bits (48), Expect = 9.6 Identities = 10/31 (32%), Positives = 14/31 (45%) Frame = -2 Query: 221 RSC*RLVFLDVKHRKPSACAPTICWS*TCEC 129 R C RL + ++ C P C+ T EC Sbjct: 477 REC-RLGYFNLDAENKFGCTPCFCYGHTLEC 506 >AF080563-1|AAC31943.1| 310|Anopheles gambiae Ultrabithorax homeotic protein IVa protein. Length = 310 Score = 23.4 bits (48), Expect = 9.6 Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 7/48 (14%) Frame = +2 Query: 332 YDTLDLAKKFEPKHRLAR-------HGLYEKKRPTRKQRKERKNRMKK 454 Y TL+L K+F H L R H L +R + + R+ ++KK Sbjct: 229 YQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKK 276 >AF080562-1|AAC31942.1| 327|Anopheles gambiae Ultrabithorax homeotic protein IIa protein. Length = 327 Score = 23.4 bits (48), Expect = 9.6 Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 7/48 (14%) Frame = +2 Query: 332 YDTLDLAKKFEPKHRLAR-------HGLYEKKRPTRKQRKERKNRMKK 454 Y TL+L K+F H L R H L +R + + R+ ++KK Sbjct: 246 YQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKK 293 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 798,939 Number of Sequences: 2352 Number of extensions: 14978 Number of successful extensions: 14 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 97160985 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -