BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_F16 (897 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g18610.1 68416.m02365 nucleolin, putative contains Pfam profi... 30 2.4 At3g50230.1 68416.m05493 leucine-rich repeat transmembrane prote... 29 3.2 At1g24220.1 68414.m03054 paired amphipathic helix repeat-contain... 29 3.2 At5g45050.2 68418.m05524 disease resistance protein-related simi... 29 5.5 At5g45050.1 68418.m05523 disease resistance protein-related simi... 29 5.5 At3g19830.1 68416.m02512 C2 domain-containing protein low simila... 29 5.5 At5g58040.1 68418.m07263 fip1 motif-containing protein contains ... 28 7.3 At3g20830.1 68416.m02634 protein kinase family protein contains ... 28 7.3 >At3g18610.1 68416.m02365 nucleolin, putative contains Pfam profile: PF00076 RNA recognition motif Length = 636 Score = 29.9 bits (64), Expect = 2.4 Identities = 16/39 (41%), Positives = 21/39 (53%) Frame = -3 Query: 745 PTA*AMRKRHASRREKGGQVSGKRQGRNRRAHEGASRGK 629 P A R RH+ R +GG+ S R R R + GA RG+ Sbjct: 571 PARGAPRGRHSDRAPRGGRFS-DRAPRGRHSDRGAPRGR 608 >At3g50230.1 68416.m05493 leucine-rich repeat transmembrane protein kinase, putative receptor-like protein kinase (RKL1), Arabidopsis thaliana, EMBL:AF084034 Length = 660 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = +2 Query: 647 LVRSPVPTLPLTGYLSAFLPSGSVAL 724 L+R +LP T Y +FLPS +VAL Sbjct: 15 LLRISTASLPATNYFDSFLPSDAVAL 40 >At1g24220.1 68414.m03054 paired amphipathic helix repeat-containing protein weak similarity to transcription co-repressor Sin3 [Xenopus laevis] GI:4960210; contains Pfam profile PF02671: Paired amphipathic helix repeat Length = 744 Score = 29.5 bits (63), Expect = 3.2 Identities = 21/70 (30%), Positives = 34/70 (48%), Gaps = 2/70 (2%) Frame = -3 Query: 457 PLILWITVLPPLSELIPLAAAERPXXXXXXXXXXXXXQYANRLSPRVGRFI--NAEKTSH 284 P+ L IT++PP + + A++P + N+L P+ R I AEK +H Sbjct: 264 PVKLKITIIPPKARRTIPSEADKPTHTDELN-------FMNKLPPKRRRTIPSEAEKPTH 316 Query: 283 TSXLNLKHKM 254 T LN +K+ Sbjct: 317 TDELNFMNKL 326 >At5g45050.2 68418.m05524 disease resistance protein-related similar to NL27 [Solanum tuberosum] GI:3947735; contains Pfam profiles PF03106: WRKY DNA -binding domain, PF00931: NB-ARC domain, PF00560: Leucine Rich Repeat Length = 1344 Score = 28.7 bits (61), Expect = 5.5 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +2 Query: 356 PLPRSLTRCARSFGCGERYQLTQRR 430 P PRS RCA S GC R Q+ + R Sbjct: 1169 PYPRSYYRCASSKGCFARKQVERSR 1193 >At5g45050.1 68418.m05523 disease resistance protein-related similar to NL27 [Solanum tuberosum] GI:3947735; contains Pfam profiles PF03106: WRKY DNA -binding domain, PF00931: NB-ARC domain, PF00560: Leucine Rich Repeat Length = 1372 Score = 28.7 bits (61), Expect = 5.5 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +2 Query: 356 PLPRSLTRCARSFGCGERYQLTQRR 430 P PRS RCA S GC R Q+ + R Sbjct: 1197 PYPRSYYRCASSKGCFARKQVERSR 1221 >At3g19830.1 68416.m02512 C2 domain-containing protein low similarity to GLUT4 vesicle protein [Rattus norvegicus] GI:4193489; contains Pfam profile PF00168: C2 domain Length = 666 Score = 28.7 bits (61), Expect = 5.5 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +2 Query: 494 KRPGTVKRPRCWRFSIGSAPLXEHHKNRRSSQR 592 K+P V+R +FS+G PL + RR+S+R Sbjct: 238 KKPDYVQRVEIKQFSLGDEPLSVRNVERRTSRR 270 >At5g58040.1 68418.m07263 fip1 motif-containing protein contains Pfam profile PF05182: Fip1 motif Length = 1192 Score = 28.3 bits (60), Expect = 7.3 Identities = 15/47 (31%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = -3 Query: 793 VHTAQXGANDLH--RTEIPTA*AMRKRHASRREKGGQVSGKRQGRNR 659 V T G ND R+EIP KRH G ++ ++GR + Sbjct: 1007 VVTGSKGTNDARNCRSEIPHQPNTAKRHKENASSGDEIHDSKRGRTK 1053 >At3g20830.1 68416.m02634 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 408 Score = 28.3 bits (60), Expect = 7.3 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -2 Query: 347 PIRKPPLPARWPIH*CRKNLPHL 279 P PP P R P H CRKN P + Sbjct: 384 PSSAPPSPLRSPPHVCRKNDPFI 406 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,570,505 Number of Sequences: 28952 Number of extensions: 354185 Number of successful extensions: 910 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 881 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 909 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2110422216 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -