BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_F13 (875 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 26 1.7 AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering In... 26 1.7 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 25.8 bits (54), Expect = 1.7 Identities = 11/41 (26%), Positives = 18/41 (43%) Frame = +3 Query: 291 HQKAKHFKCHICHKKLYTGPGLSIHCMQVHKEAIDKVPNSL 413 H+ H +C +C +K + HC H E D+ N + Sbjct: 918 HRPQSH-ECPVCGQKFTRRDNMKAHCKVKHPELRDRFYNHI 957 >AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering Institute proto-oncogeneproduct protein. Length = 358 Score = 25.8 bits (54), Expect = 1.7 Identities = 14/49 (28%), Positives = 19/49 (38%) Frame = +2 Query: 539 SCQEKSYSSIAGCRPFDSVTXDIAHTHGASATRXVSWTFSXESXDASIH 685 S E+S A CR S + H H R W F+ + + IH Sbjct: 248 SYDEQSCIECAECRGLFSPQKFVCHQHEPQEIRTCHWGFNSSNWRSYIH 296 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 734,904 Number of Sequences: 2352 Number of extensions: 13712 Number of successful extensions: 39 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 36 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 39 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 93853377 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -