BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_F12 (903 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc... 25 2.4 AY263176-1|AAP78791.1| 705|Anopheles gambiae TmcB-like protein ... 24 5.5 >EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium channel alpha2-delta subunit 1 protein. Length = 1256 Score = 25.4 bits (53), Expect = 2.4 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -2 Query: 290 HAATLLQPLVEYSASQELHWSMKF 219 +A + +P+V Y A +HWS F Sbjct: 447 YALVMARPMVLYQADHPVHWSPVF 470 >AY263176-1|AAP78791.1| 705|Anopheles gambiae TmcB-like protein protein. Length = 705 Score = 24.2 bits (50), Expect = 5.5 Identities = 13/38 (34%), Positives = 24/38 (63%), Gaps = 1/38 (2%) Frame = +1 Query: 127 IGMVRSSIGLLWIFYSFLPP*ILRIA-EVTLVNFMDQC 237 +G+V + LLW F PP +L +A ++ LV ++++C Sbjct: 463 LGLVYNQT-LLWFGVLFAPPLLLLVALKLLLVFYVNKC 499 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 715,340 Number of Sequences: 2352 Number of extensions: 11834 Number of successful extensions: 11 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 97574436 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -