BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_F08 (892 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 24 2.1 AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein... 23 2.8 AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein... 23 2.8 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 23.8 bits (49), Expect = 2.1 Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 2/49 (4%) Frame = +1 Query: 310 KLVQALCNEHQIPLVKVDNNKKLGEWAGLCKIDKDGKARK--IVGCSCV 450 KL+ + E L +VD + LGE L D K +K + GC CV Sbjct: 564 KLIDNIKKEIYDILPEVDVEEILGEAKVLQNFDIKDKNKKVNVAGCRCV 612 >AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 23.4 bits (48), Expect = 2.8 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = +2 Query: 347 HWSRLTTTKSLENGLVSARLTRMARQGKLSAAPVLSSKIS 466 HWSR T SL+N +S ++ + Q L P +S I+ Sbjct: 22 HWSRGNTWLSLDNSNMS--MSSVGPQSPLDMKPDTASLIN 59 >AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 23.4 bits (48), Expect = 2.8 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = +2 Query: 347 HWSRLTTTKSLENGLVSARLTRMARQGKLSAAPVLSSKIS 466 HWSR T SL+N +S ++ + Q L P +S I+ Sbjct: 22 HWSRGNTWLSLDNSNMS--MSSVGPQSPLDMKPDTASLIN 59 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 157,394 Number of Sequences: 438 Number of extensions: 2501 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 28783482 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -