BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_F06 (905 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z93389-1|CAB07668.1| 346|Caenorhabditis elegans Hypothetical pr... 29 6.0 Z70686-10|CAD21656.1| 533|Caenorhabditis elegans Hypothetical p... 28 8.0 Z70683-8|CAD21626.1| 533|Caenorhabditis elegans Hypothetical pr... 28 8.0 >Z93389-1|CAB07668.1| 346|Caenorhabditis elegans Hypothetical protein T13F3.1 protein. Length = 346 Score = 28.7 bits (61), Expect = 6.0 Identities = 19/65 (29%), Positives = 33/65 (50%), Gaps = 1/65 (1%) Frame = -1 Query: 593 FNFHVDKILRIS-FVWSR*NEAGGVRALDNSYVVGV*EHSLVHVDSGVACCFVETFKIFG 417 ++ +D I+ I+ FVW R NE GV+ L+ +G+ LV + S + T + Sbjct: 171 YDLKIDDIVYIAAFVWPR-NETTGVKYLNKRSAIGIGFDQLVVIISLTVIAYCGTCCYYK 229 Query: 416 IIEQL 402 I +Q+ Sbjct: 230 IQQQM 234 >Z70686-10|CAD21656.1| 533|Caenorhabditis elegans Hypothetical protein F13B12.6 protein. Length = 533 Score = 28.3 bits (60), Expect = 8.0 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 4/50 (8%) Frame = -1 Query: 428 KIFGIIEQLEQRDGFFPHFFV-KDRE-FQILGKESDLVHHHEIF--VGFH 291 +I+G RDG F HF V K +E +Q LG ++ V H E+F V +H Sbjct: 424 RIWGYTVSYASRDGSFKHFLVEKIKEGYQFLG--TNQVVHDELFDLVAYH 471 >Z70683-8|CAD21626.1| 533|Caenorhabditis elegans Hypothetical protein F13B12.6 protein. Length = 533 Score = 28.3 bits (60), Expect = 8.0 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 4/50 (8%) Frame = -1 Query: 428 KIFGIIEQLEQRDGFFPHFFV-KDRE-FQILGKESDLVHHHEIF--VGFH 291 +I+G RDG F HF V K +E +Q LG ++ V H E+F V +H Sbjct: 424 RIWGYTVSYASRDGSFKHFLVEKIKEGYQFLG--TNQVVHDELFDLVAYH 471 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,159,775 Number of Sequences: 27780 Number of extensions: 366651 Number of successful extensions: 1027 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 999 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1027 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2307803960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -