BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_F02 (941 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC11G7.02 |pub1||ubiquitin-protein ligase E3|Schizosaccharomyc... 27 5.1 SPCC645.06c |rgf3|lad1|RhoGEF Rgf3|Schizosaccharomyces pombe|chr... 26 6.7 >SPAC11G7.02 |pub1||ubiquitin-protein ligase E3|Schizosaccharomyces pombe|chr 1|||Manual Length = 767 Score = 26.6 bits (56), Expect = 5.1 Identities = 16/50 (32%), Positives = 23/50 (46%) Frame = +1 Query: 334 HPLFCRWYGLEGVRSQKNQTSDSKQRSAMIGDHLNTYTIICCQICLSLFH 483 H +F +Y L S N T S + +HLN + I I L++FH Sbjct: 467 HEMFNPFYCLFEYSSVDNYTLQINPHSGINPEHLNYFKFIGRVIGLAIFH 516 >SPCC645.06c |rgf3|lad1|RhoGEF Rgf3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1275 Score = 26.2 bits (55), Expect = 6.7 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +1 Query: 436 NTYTIICCQICLSLFHN 486 NT TIICC+ + L HN Sbjct: 1056 NTTTIICCEPVIGLGHN 1072 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,038,682 Number of Sequences: 5004 Number of extensions: 33180 Number of successful extensions: 55 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 55 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 55 length of database: 2,362,478 effective HSP length: 73 effective length of database: 1,997,186 effective search space used: 479324640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -