BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_F02 (941 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g47390.1 68415.m05915 expressed protein 30 1.9 At5g25510.1 68418.m03035 serine/threonine protein phosphatase 2A... 29 4.5 >At2g47390.1 68415.m05915 expressed protein Length = 961 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = -3 Query: 276 IWLFRSRVACACLCAQARRPPELVLAPPGPKTLVPESLT 160 +W+ S + + + + PP+ L P GPKTL E+ T Sbjct: 264 VWIDNSTLLVSTIPSSRGEPPKKPLVPSGPKTLSNETKT 302 >At5g25510.1 68418.m03035 serine/threonine protein phosphatase 2A (PP2A) regulatory subunit B', putative similar to SWISS-PROT:Q28653 serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, delta isoform (PP2A, B subunit, B' delta isoform, PP2A, B subunit, B56 delta isoform, PP2A, B subunit, PR61 delta isoform, PP2A, B subunit, R5 delta isoform, PP2A, B subunit, B'-gamma) [Oryctolagus cuniculus]; contains Pfam domain, PF01603: Protein phosphatase 2A regulatory B subunit (B56 family) Length = 500 Score = 29.1 bits (62), Expect = 4.5 Identities = 17/36 (47%), Positives = 22/36 (61%) Frame = +2 Query: 128 RSFMPPAAXSPVRLSGTSVXGPGGASTNSGGRLAWA 235 RS P + SPV+ SGTS G G +NSG R++ A Sbjct: 23 RSSSGPVS-SPVQRSGTSGGGSGPVRSNSGKRMSSA 57 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,328,801 Number of Sequences: 28952 Number of extensions: 198993 Number of successful extensions: 468 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 435 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 468 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2256303936 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -