BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_E22 (907 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81062-8|CAD59145.1| 808|Caenorhabditis elegans Hypothetical pr... 29 4.6 AF003133-3|AAB54138.2| 2192|Caenorhabditis elegans Low-density l... 29 6.0 >Z81062-8|CAD59145.1| 808|Caenorhabditis elegans Hypothetical protein F15A4.8b protein. Length = 808 Score = 29.1 bits (62), Expect = 4.6 Identities = 16/48 (33%), Positives = 24/48 (50%) Frame = +1 Query: 544 PXVWKTXEFTSRSCPPRTNSX*SSITRKVLXMXVSSTVIAPLTPSNTT 687 P V T S + PP ++ + +T+ V ST IAP+T +TT Sbjct: 423 PDVTSTTTTKSSTTPPVESTTTAPVTKSSSTPPVKSTTIAPVTMPSTT 470 >AF003133-3|AAB54138.2| 2192|Caenorhabditis elegans Low-density lipoprotein receptorrelated protein 2 protein. Length = 2192 Score = 28.7 bits (61), Expect = 6.0 Identities = 17/55 (30%), Positives = 24/55 (43%) Frame = -3 Query: 278 DNXXLLXLQIFRAXGDSGLVFTXDDTHIQXLRQYVISSWCKCGVRSQRTHGEDEG 114 DN + Q FR+ G S + + + ISSW +C + GEDEG Sbjct: 795 DNFTCMCAQGFRSEGRSCVSECKPNDFVCTKTYKCISSWWRCDGQDDCGDGEDEG 849 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,310,178 Number of Sequences: 27780 Number of extensions: 218094 Number of successful extensions: 454 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 451 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 454 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2307803960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -