BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_E22 (907 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g62250.2 68414.m07023 expressed protein 30 1.8 At1g62250.1 68414.m07022 expressed protein 30 1.8 >At1g62250.2 68414.m07023 expressed protein Length = 223 Score = 30.3 bits (65), Expect = 1.8 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +1 Query: 106 LCLPSSSPCVRWLLTPHLHQELMTYWRSXC 195 LC P + +RW TP + E+++ WR C Sbjct: 181 LCTPQPT-VIRWSSTPSVSDEILSKWRGFC 209 >At1g62250.1 68414.m07022 expressed protein Length = 267 Score = 30.3 bits (65), Expect = 1.8 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +1 Query: 106 LCLPSSSPCVRWLLTPHLHQELMTYWRSXC 195 LC P + +RW TP + E+++ WR C Sbjct: 181 LCTPQPT-VIRWSSTPSVSDEILSKWRGFC 209 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,660,964 Number of Sequences: 28952 Number of extensions: 205342 Number of successful extensions: 369 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 364 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 369 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2139598560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -