BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_E20 (888 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z68338-1|CAA92757.1| 134|Caenorhabditis elegans Hypothetical pr... 153 2e-37 AL132848-1|CAB60388.2| 381|Caenorhabditis elegans Hypothetical ... 29 4.4 >Z68338-1|CAA92757.1| 134|Caenorhabditis elegans Hypothetical protein T24B8.1 protein. Length = 134 Score = 153 bits (370), Expect = 2e-37 Identities = 69/124 (55%), Positives = 95/124 (76%) Frame = +3 Query: 138 IVKKRPQRFXXHQSXRXAKLKRXWRKPXGXDNXVRRRFKGQYLMPNIGYGSNKKXRHMLP 317 +VKK+ +F H+S R ++ WRKP G DN VRRRF+G MP IG+GS+++ R +LP Sbjct: 11 VVKKKLTKFKRHESDRYRRVAPSWRKPKGIDNRVRRRFRGMRAMPTIGHGSDRRTRFVLP 70 Query: 318 NGFRKVLVHNVKELEILMMQNRKYCAEIAHGVSSKKRKLIVERAQQLSIRVTNAXARLRS 497 NG++KVLV NVK+L++L+MQ+ KY EI HGVS+K RK IVERA QL+I++TN ARLR+ Sbjct: 71 NGYKKVLVQNVKDLDMLLMQSYKYIGEIGHGVSAKSRKGIVERAAQLNIKLTNGNARLRT 130 Query: 498 QENE 509 +E+E Sbjct: 131 EESE 134 >AL132848-1|CAB60388.2| 381|Caenorhabditis elegans Hypothetical protein Y47H10A.2 protein. Length = 381 Score = 29.1 bits (62), Expect = 4.4 Identities = 16/41 (39%), Positives = 20/41 (48%) Frame = +3 Query: 258 QYLMPNIGYGSNKKXRHMLPNGFRKVLVHNVKELEILMMQN 380 QYLM NI R P+GF K L+ + L+I QN Sbjct: 213 QYLMNNIDLKYGLLIRCWHPSGFDKELLSGIPRLDIFYAQN 253 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,288,491 Number of Sequences: 27780 Number of extensions: 188858 Number of successful extensions: 387 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 385 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 387 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2244863852 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -