BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_E20 (888 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF441189-1|AAL73401.1| 134|Apis mellifera ribosomal protein 49 ... 227 8e-62 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 3.7 >AF441189-1|AAL73401.1| 134|Apis mellifera ribosomal protein 49 protein. Length = 134 Score = 227 bits (556), Expect = 8e-62 Identities = 109/130 (83%), Positives = 114/130 (87%) Frame = +3 Query: 120 PVXRPTIVKKRPQRFXXHQSXRXAKLKRXWRKPXGXDNXVRRRFKGQYLMPNIGYGSNKK 299 PV RPTIVKKR ++F HQS R +KLKR WRKP G DN VRRRFKGQYLMPNIGYGSNKK Sbjct: 5 PVYRPTIVKKRTKKFIRHQSDRYSKLKRNWRKPKGIDNRVRRRFKGQYLMPNIGYGSNKK 64 Query: 300 XRHMLPNGFRKVLVHNVKELEILMMQNRKYCAEIAHGVSSKKRKLIVERAQQLSIRVTNA 479 RHMLP GFRKVLVHNVKELE+LMMQNRK+CAEIAHG SSKKRK IVERAQQLSIRVT A Sbjct: 65 TRHMLPTGFRKVLVHNVKELEVLMMQNRKFCAEIAHGGSSKKRKSIVERAQQLSIRVTYA 124 Query: 480 XARLRSQENE 509 ARLRSQENE Sbjct: 125 SARLRSQENE 134 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 23.0 bits (47), Expect = 3.7 Identities = 14/61 (22%), Positives = 28/61 (45%) Frame = +3 Query: 264 LMPNIGYGSNKKXRHMLPNGFRKVLVHNVKELEILMMQNRKYCAEIAHGVSSKKRKLIVE 443 L + G + + +P+G+ + + EL L + + + + HG+ R LIV+ Sbjct: 66 LAAKVWNGQYARVQQSMPDGWETEISDQMLELRDLPISGKPFQIRMKHGLI---RDLIVD 122 Query: 444 R 446 R Sbjct: 123 R 123 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 159,466 Number of Sequences: 438 Number of extensions: 2403 Number of successful extensions: 12 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 28662543 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -