BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_E20 (888 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g18100.1 68417.m02692 60S ribosomal protein L32 (RPL32A) ribo... 173 1e-43 At5g46430.2 68418.m05716 60S ribosomal protein L32 (RPL32B) 170 9e-43 At5g46430.1 68418.m05715 60S ribosomal protein L32 (RPL32B) 170 9e-43 At5g51860.1 68418.m06429 MADS-box protein (AGL72) contains Pfam ... 28 9.5 >At4g18100.1 68417.m02692 60S ribosomal protein L32 (RPL32A) ribosomal protein L32, human, PIR1:R5HU32 Length = 133 Score = 173 bits (422), Expect = 1e-43 Identities = 81/130 (62%), Positives = 96/130 (73%) Frame = +3 Query: 120 PVXRPTIVKKRPQRFXXHQSXRXAKLKRXWRKPXGXDNXVRRRFKGQYLMPNIGYGSNKK 299 P+ +VKKR +F QS R +K WR+P G D+ VRR+FKG LMPN+GYGS+KK Sbjct: 4 PLLTKKVVKKRSAKFIRPQSDRRITVKESWRRPKGIDSRVRRKFKGVTLMPNVGYGSDKK 63 Query: 300 XRHMLPNGFRKVLVHNVKELEILMMQNRKYCAEIAHGVSSKKRKLIVERAQQLSIRVTNA 479 RH LPNGF+K +VHN ELE+LMM NR YCAEIAH VS+KKRK IVERA QL + VTN Sbjct: 64 TRHYLPNGFKKFVVHNTSELELLMMHNRTYCAEIAHNVSTKKRKAIVERASQLDVVVTNR 123 Query: 480 XARLRSQENE 509 ARLRSQE+E Sbjct: 124 LARLRSQEDE 133 >At5g46430.2 68418.m05716 60S ribosomal protein L32 (RPL32B) Length = 133 Score = 170 bits (414), Expect = 9e-43 Identities = 78/130 (60%), Positives = 95/130 (73%) Frame = +3 Query: 120 PVXRPTIVKKRPQRFXXHQSXRXAKLKRXWRKPXGXDNXVRRRFKGQYLMPNIGYGSNKK 299 P+ +VKKR +F QS R +K WR+P G D+ VRR+FKG LMPN+GYGS+KK Sbjct: 4 PLLTKKVVKKRSAKFIRPQSDRRITVKESWRRPKGIDSRVRRKFKGVTLMPNVGYGSDKK 63 Query: 300 XRHMLPNGFRKVLVHNVKELEILMMQNRKYCAEIAHGVSSKKRKLIVERAQQLSIRVTNA 479 RH LPNGF+K +VHN ELE+LMM NR YCAEIAH +S+KKRK IVERA QL + V+N Sbjct: 64 TRHYLPNGFKKFIVHNTSELELLMMHNRTYCAEIAHNISTKKRKAIVERASQLDVVVSNK 123 Query: 480 XARLRSQENE 509 RLRSQE+E Sbjct: 124 LGRLRSQEDE 133 >At5g46430.1 68418.m05715 60S ribosomal protein L32 (RPL32B) Length = 133 Score = 170 bits (414), Expect = 9e-43 Identities = 78/130 (60%), Positives = 95/130 (73%) Frame = +3 Query: 120 PVXRPTIVKKRPQRFXXHQSXRXAKLKRXWRKPXGXDNXVRRRFKGQYLMPNIGYGSNKK 299 P+ +VKKR +F QS R +K WR+P G D+ VRR+FKG LMPN+GYGS+KK Sbjct: 4 PLLTKKVVKKRSAKFIRPQSDRRITVKESWRRPKGIDSRVRRKFKGVTLMPNVGYGSDKK 63 Query: 300 XRHMLPNGFRKVLVHNVKELEILMMQNRKYCAEIAHGVSSKKRKLIVERAQQLSIRVTNA 479 RH LPNGF+K +VHN ELE+LMM NR YCAEIAH +S+KKRK IVERA QL + V+N Sbjct: 64 TRHYLPNGFKKFIVHNTSELELLMMHNRTYCAEIAHNISTKKRKAIVERASQLDVVVSNK 123 Query: 480 XARLRSQENE 509 RLRSQE+E Sbjct: 124 LGRLRSQEDE 133 >At5g51860.1 68418.m06429 MADS-box protein (AGL72) contains Pfam profile PF00319: SRF-type transcription factor (DNA-binding and dimerisation domain); Length = 211 Score = 27.9 bits (59), Expect = 9.5 Identities = 17/61 (27%), Positives = 29/61 (47%) Frame = +3 Query: 321 GFRKVLVHNVKELEILMMQNRKYCAEIAHGVSSKKRKLIVERAQQLSIRVTNAXARLRSQ 500 G +K +V VK++E+L + NRK + S K+ I + ++ V A+L Sbjct: 90 GLKKEMVTMVKKIEVLEVHNRKMMGQSLDSCSVKELSEIATQIEKSLHMVRLRKAKLYED 149 Query: 501 E 503 E Sbjct: 150 E 150 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,762,252 Number of Sequences: 28952 Number of extensions: 179413 Number of successful extensions: 396 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 389 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 396 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2081245872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -