BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_E17 (890 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ013849-1|AAY40258.1| 264|Anopheles gambiae CYP325C2 protein. 24 5.4 AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcript... 23 9.4 >DQ013849-1|AAY40258.1| 264|Anopheles gambiae CYP325C2 protein. Length = 264 Score = 24.2 bits (50), Expect = 5.4 Identities = 17/67 (25%), Positives = 28/67 (41%) Frame = +3 Query: 24 YREFLKIFDTPLCCSPVRISSALSLSTVHHGRQVRSSLRLHRSGPRSDGATRRSRLLQGH 203 YRE + +F P + + L+ + R ++ SLRL SGP T + + G Sbjct: 98 YREVMDVFPDP--DQDIEVEDLKKLTYME--RVIKESLRLAPSGPNIARQTMKDIEIAGV 153 Query: 204 RTPHQGV 224 P + Sbjct: 154 HIPRDSL 160 >AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcriptase protein. Length = 1049 Score = 23.4 bits (48), Expect = 9.4 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -2 Query: 634 TSWVFFAKSS*AAWILGASFSLVSCTFE 551 +SWV + A W+ G +VS TFE Sbjct: 43 SSWVADKTGNAAIWVTGTIQRVVSNTFE 70 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 643,832 Number of Sequences: 2352 Number of extensions: 10326 Number of successful extensions: 29 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 95920632 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -