BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= MFBP02_F_E15
(952 letters)
Database: uniref50
1,657,284 sequences; 575,637,011 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
UniRef50_Q2C3D2 Cluster: Chitinase, containing dual catalytic do... 35 2.6
>UniRef50_Q2C3D2 Cluster: Chitinase, containing dual catalytic
domains; n=3; Vibrionaceae|Rep: Chitinase, containing
dual catalytic domains - Photobacterium sp. SKA34
Length = 399
Score = 35.1 bits (77), Expect = 2.6
Identities = 17/43 (39%), Positives = 23/43 (53%)
Frame = +3
Query: 117 MKFTVAFALIAMFAIVAVNSQENGGDSPDGEVAPGVDPVKVVD 245
MK+T+ ALIA ++ A NS N D G VA P K+ +
Sbjct: 1 MKYTLLAALIAATSLTACNSSSNSSDDYSGYVAQEPKPAKITE 43
Database: uniref50
Posted date: Oct 5, 2007 11:19 AM
Number of letters in database: 575,637,011
Number of sequences in database: 1,657,284
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 312,900,539
Number of Sequences: 1657284
Number of extensions: 4775593
Number of successful extensions: 14564
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 14077
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 14542
length of database: 575,637,011
effective HSP length: 101
effective length of database: 408,251,327
effective search space used: 87774035305
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -