BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_E15 (952 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q2C3D2 Cluster: Chitinase, containing dual catalytic do... 35 2.6 >UniRef50_Q2C3D2 Cluster: Chitinase, containing dual catalytic domains; n=3; Vibrionaceae|Rep: Chitinase, containing dual catalytic domains - Photobacterium sp. SKA34 Length = 399 Score = 35.1 bits (77), Expect = 2.6 Identities = 17/43 (39%), Positives = 23/43 (53%) Frame = +3 Query: 117 MKFTVAFALIAMFAIVAVNSQENGGDSPDGEVAPGVDPVKVVD 245 MK+T+ ALIA ++ A NS N D G VA P K+ + Sbjct: 1 MKYTLLAALIAATSLTACNSSSNSSDDYSGYVAQEPKPAKITE 43 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 312,900,539 Number of Sequences: 1657284 Number of extensions: 4775593 Number of successful extensions: 14564 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 14077 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14542 length of database: 575,637,011 effective HSP length: 101 effective length of database: 408,251,327 effective search space used: 87774035305 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -