BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_E12 (934 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_51630| Best HMM Match : Fz (HMM E-Value=3.3e-34) 32 0.76 SB_22258| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 29 5.4 SB_15022| Best HMM Match : Zona_pellucida (HMM E-Value=5.6e-38) 29 7.1 >SB_51630| Best HMM Match : Fz (HMM E-Value=3.3e-34) Length = 1120 Score = 31.9 bits (69), Expect = 0.76 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +2 Query: 164 KRLVPHPNSYFMDVKCPGCYKITTVFSHAQRV 259 KR P P ++K P Y++TT+ +H+ RV Sbjct: 428 KRTKPKPGERATEIKSPSTYQVTTMVTHSPRV 459 >SB_22258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 549 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +2 Query: 365 PGXEPYLILRFFFQLYNGVIFFKFTTMD 448 PG EP+L+L FF L +G + T +D Sbjct: 504 PGAEPWLVLALFFSLLSGFSVVQCTRLD 531 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 29.1 bits (62), Expect = 5.4 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 587 GXAXPPXGGXXXPPXKKKXXXXXXPPPP 670 G A PP GG PP PPPP Sbjct: 352 GMAPPPVGGAAPPPPPPPPVGGPPPPPP 379 >SB_15022| Best HMM Match : Zona_pellucida (HMM E-Value=5.6e-38) Length = 525 Score = 28.7 bits (61), Expect = 7.1 Identities = 8/25 (32%), Positives = 18/25 (72%) Frame = +2 Query: 275 CSTILCQPTGGRARLTEGCSFRRKQ 349 C ++CQ + ++R T+GC ++R++ Sbjct: 230 CEVLVCQRSDKKSRCTKGCPYQRRR 254 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,975,081 Number of Sequences: 59808 Number of extensions: 297463 Number of successful extensions: 692 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 566 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 687 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2717121828 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -