BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_E11 (896 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. 26 1.4 AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 24 7.2 AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T... 24 7.2 >AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. Length = 1132 Score = 26.2 bits (55), Expect = 1.4 Identities = 23/76 (30%), Positives = 32/76 (42%) Frame = -1 Query: 536 TPPPSVLKLGALGMALGEFLIANALALRSWLLLWNKLTLPATPSCSPKPGMRVPVRLSPC 357 TP PS A +++GEF + S L + P++PS P R +SP Sbjct: 35 TPSPSSSSAAAAVVSVGEFTLGPGRTYASALSPSSSSASPSSPSSVASPNSRAS-NMSP- 92 Query: 356 PFTLSRASPAEAALSL 309 S AS AA +L Sbjct: 93 ---ESSASDQSAAYTL 105 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 23.8 bits (49), Expect = 7.2 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = -1 Query: 425 TLPATPSCSPKPGMRVPVRLSPCPFTLSRA 336 +LP TP P R PV CP L+ A Sbjct: 1365 SLPLTPPSVPYASDRPPVATFSCPDGLAHA 1394 >AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1978 Score = 23.8 bits (49), Expect = 7.2 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = -1 Query: 425 TLPATPSCSPKPGMRVPVRLSPCPFTLSRA 336 +LP TP P R PV CP L+ A Sbjct: 1362 SLPLTPPSVPYASDRPPVATFSCPDGLAHA 1391 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 749,730 Number of Sequences: 2352 Number of extensions: 14715 Number of successful extensions: 18 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 96747534 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -