BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_E07 (890 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46258| Best HMM Match : Vicilin_N (HMM E-Value=4.7) 30 2.9 SB_19950| Best HMM Match : AIP3 (HMM E-Value=1.7) 29 3.8 >SB_46258| Best HMM Match : Vicilin_N (HMM E-Value=4.7) Length = 406 Score = 29.9 bits (64), Expect = 2.9 Identities = 12/42 (28%), Positives = 23/42 (54%) Frame = +2 Query: 467 QNHNKIAFGDSKDKTSKKVSWKFTPXVGKQQSLLQDHVHRGQ 592 + K+ + D++DK +K++W T G+Q+ D +GQ Sbjct: 9 KRRQKMTWDDTRDKRRQKMTWDDTQDEGRQKMTRDDMWDKGQ 50 >SB_19950| Best HMM Match : AIP3 (HMM E-Value=1.7) Length = 427 Score = 29.5 bits (63), Expect = 3.8 Identities = 20/64 (31%), Positives = 28/64 (43%), Gaps = 5/64 (7%) Frame = +3 Query: 504 TKPARKSPGSLPPXLENNRVYFKIMSTEDKQY-----LKLDNTKGSSDDRIIYGDSTADT 668 TKP R SPG+ PP + N+ ++S +K Y K SDD ++ G S Sbjct: 118 TKP-RSSPGAYPPTMRNSYSLDDVVSALEKSYETGVQFKDYLPSMESDDSLLQGSSVTSV 176 Query: 669 FKHH 680 H Sbjct: 177 DSAH 180 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,689,729 Number of Sequences: 59808 Number of extensions: 496598 Number of successful extensions: 1277 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1132 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1277 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2550281014 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -