BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_E07 (890 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK055595-1|BAB70966.1| 729|Homo sapiens protein ( Homo sapiens ... 31 5.6 >AK055595-1|BAB70966.1| 729|Homo sapiens protein ( Homo sapiens cDNA FLJ31033 fis, clone HSYRA1000168, weakly similar to HYPOTHETICAL HELICASE C28H8.3 IN CHROMOSOME III. ). Length = 729 Score = 31.1 bits (67), Expect = 5.6 Identities = 14/52 (26%), Positives = 26/52 (50%) Frame = +3 Query: 492 VTPKTKPARKSPGSLPPXLENNRVYFKIMSTEDKQYLKLDNTKGSSDDRIIY 647 VT T+P S G+ L+N + + ++ K +LK D K +D +++ Sbjct: 103 VTQTTRPKEDSSGASGEILQNTKPHQITKKSKKKSFLKEDQNKAQQNDDLLF 154 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 116,067,658 Number of Sequences: 237096 Number of extensions: 2403758 Number of successful extensions: 5681 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 5409 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5681 length of database: 76,859,062 effective HSP length: 90 effective length of database: 55,520,422 effective search space used: 11437206932 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -