BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_E06 (869 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory recept... 23 2.4 AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless prot... 22 5.5 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 22 5.5 AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory recept... 22 7.2 AM292345-1|CAL23157.2| 384|Tribolium castaneum gustatory recept... 22 7.2 >AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory receptor candidate 59 protein. Length = 489 Score = 23.4 bits (48), Expect = 2.4 Identities = 11/38 (28%), Positives = 19/38 (50%) Frame = +1 Query: 406 SLLVSLPLQIKHLLTWREVLKKLLYQLPVLMPPCLLWV 519 S L L ++KH+L W+ + ++ L LLW+ Sbjct: 109 SKLHKLDNKLKHMLIWKSYKRTQIFITCELFFVILLWI 146 >AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless protein. Length = 302 Score = 22.2 bits (45), Expect = 5.5 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = -1 Query: 509 KHGGISTGS*YNNFFSTSLQVSRCFICSGKD 417 KH I FF S++ +R ++C KD Sbjct: 48 KHYNIFACDGCAGFFKRSIRRNRQYVCKAKD 78 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 22.2 bits (45), Expect = 5.5 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = -1 Query: 509 KHGGISTGS*YNNFFSTSLQVSRCFICSGKD 417 KH I FF S++ +R ++C KD Sbjct: 48 KHYNIFACDGCAGFFKRSIRRNRQYVCKAKD 78 >AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory receptor candidate 53 protein. Length = 659 Score = 21.8 bits (44), Expect = 7.2 Identities = 7/20 (35%), Positives = 14/20 (70%) Frame = +1 Query: 664 LHRKLLMDLLENYGVMAVVL 723 +HRK+++ L GV+ V++ Sbjct: 404 VHRKIMVQSLGRVGVLVVII 423 >AM292345-1|CAL23157.2| 384|Tribolium castaneum gustatory receptor candidate 24 protein. Length = 384 Score = 21.8 bits (44), Expect = 7.2 Identities = 7/20 (35%), Positives = 14/20 (70%) Frame = +1 Query: 664 LHRKLLMDLLENYGVMAVVL 723 +HRK+++ L GV+ V++ Sbjct: 129 VHRKIMVQSLGRVGVLVVII 148 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 196,147 Number of Sequences: 336 Number of extensions: 4377 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 23996456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -