BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_E06 (869 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_59557| Best HMM Match : No HMM Matches (HMM E-Value=.) 269 2e-72 SB_10790| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_2042| Best HMM Match : Amidase (HMM E-Value=0) 31 1.6 SB_15451| Best HMM Match : C4dic_mal_tran (HMM E-Value=0.7) 31 1.6 SB_20220| Best HMM Match : E-MAP-115 (HMM E-Value=2.1) 29 6.5 SB_12042| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_46249| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 >SB_59557| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1109 Score = 269 bits (660), Expect = 2e-72 Identities = 126/178 (70%), Positives = 143/178 (80%) Frame = +3 Query: 246 VYLFKYDSTHGRFKGSVEVQDGFLVVNGNKIAVFSERDPKAIPWGKAGAEYVVESTGVFT 425 VY+FKYDSTHGRFKG+VE +DG LV+NG ++VF+ +DP IPWG+ GA+YVVESTGVFT Sbjct: 817 VYMFKYDSTHGRFKGTVEAKDGKLVINGKPVSVFACKDPTQIPWGETGADYVVESTGVFT 876 Query: 426 TTDKASAHLEGGAKKVIISAPSADAPMFVVGVNLEAYDPSFKVISNASCTTNCLAPLAKV 605 T +KA HL+GGAKKVIISAPSADAPMFV+GVN E YDPS V+SNASCTTNCLAPL KV Sbjct: 877 TLEKAGFHLKGGAKKVIISAPSADAPMFVMGVNHEKYDPSMTVVSNASCTTNCLAPLVKV 936 Query: 606 IHDNFEIVEGLMXXXXXXXXXXXXXDGPSGKLWRDGRGAQQNIIPASTGAAKAVGXVI 779 I+DNF + EGLM DGPS K WRDGRGA QN+IPASTGAAKAVG VI Sbjct: 937 INDNFGLEEGLMTTIHAYTATQKTVDGPSAKNWRDGRGAHQNVIPASTGAAKAVGKVI 994 Score = 50.0 bits (114), Expect = 2e-06 Identities = 24/35 (68%), Positives = 28/35 (80%) Frame = +2 Query: 758 QSCGXGYPALNGXLTGMAFRVPVANVSVVDLTVRL 862 ++ G P +NG LTGMAFRVPVA+VSVVDLT RL Sbjct: 988 KAVGKVIPEVNGKLTGMAFRVPVADVSVVDLTCRL 1022 >SB_10790| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 368 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = +1 Query: 88 SVIQQIFYNLPITCQKLESMDLAALAVWCSVLLLKRELKWS 210 S+ + +FY I+C+KL S+D+ AL + S LL +K S Sbjct: 24 SLPKTVFYCKEISCRKLRSIDMTALRDYISSSLLHGTMKTS 64 >SB_2042| Best HMM Match : Amidase (HMM E-Value=0) Length = 796 Score = 30.7 bits (66), Expect = 1.6 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +2 Query: 746 YWCCQSCGXGYPALNGXLTGMAFRVPVANVSVVD 847 YWCC G G L+G + +PVA + +++ Sbjct: 512 YWCCDIQGAGSGKLHGKTVAIKDNIPVAGIPMMN 545 >SB_15451| Best HMM Match : C4dic_mal_tran (HMM E-Value=0.7) Length = 277 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = +1 Query: 484 LPVLMPPCLLWVLT*KLMTPLLRSSQMLL 570 +PV+MP CL + K+M PLL +++LL Sbjct: 194 IPVIMPHCLAAMSCGKVMAPLLAKAELLL 222 >SB_20220| Best HMM Match : E-MAP-115 (HMM E-Value=2.1) Length = 405 Score = 28.7 bits (61), Expect = 6.5 Identities = 17/45 (37%), Positives = 23/45 (51%) Frame = -2 Query: 481 DIITFLAPPSK*ADALSVVVKTPVDSTTYSAPAFPHGMALGSLSE 347 D+I +A P + A A S T V S +Y+ AFP G S S+ Sbjct: 175 DVIERMAAPPRDAPATSTPCPTRVLSPSYALAAFPTGENASSSSQ 219 >SB_12042| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 28.7 bits (61), Expect = 6.5 Identities = 23/82 (28%), Positives = 35/82 (42%) Frame = -1 Query: 410 RLYNIFSPSFSPWNGLRVPF*ENGNFVTVNNKESILNLNTALKTAMGGIILEKINHIVKT 231 R N+ F W GLRV + N V I N T L +I E + VK Sbjct: 6 RAANVTKIPFDGWVGLRVKLKDAANNHEVLVPFLIANQTTDLPIIGFNVIEEIVKGYVKD 65 Query: 230 DERVIYSDHLSSLFNRSTEHQT 165 ++ + S SSL++ +++ T Sbjct: 66 EDNELNSALASSLYDVESDNVT 87 >SB_46249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 834 Score = 28.3 bits (60), Expect = 8.6 Identities = 36/117 (30%), Positives = 56/117 (47%), Gaps = 3/117 (2%) Frame = +1 Query: 274 MAVLRAVLRFRMDSLLLTVTKLP-FSQKGTLRPFHGEKLGLNML*SLLVSLPLQIKHLLT 450 +A L+ V+ ++ + L +T L + L P L +L L V +PLQ+ LT Sbjct: 380 LAPLQVVITLQVLTSLQVLTSLQVLTSLQVLTPLQ-VPTPLQVLIPLQVLIPLQV---LT 435 Query: 451 WREVLKKLLYQLP--VLMPPCLLWVLT*KLMTPLLRSSQMLLAPQTVLPHLQRLFMI 615 +VL L LP VL+P +L L + +L Q+L PQ + P LQ L ++ Sbjct: 436 PLQVLIPLQVLLPLQVLIPLQVLTPLQVLITLQVLTPPQVLTPPQVLAP-LQVLILL 491 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,616,097 Number of Sequences: 59808 Number of extensions: 540938 Number of successful extensions: 1130 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1071 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1129 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2491217872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -