BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_E06 (869 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY187042-1|AAO39756.1| 248|Anopheles gambiae putative antennal ... 25 2.3 AY536865-1|AAT07965.1| 650|Anopheles gambiae tryptophan transpo... 23 9.2 AJ626713-1|CAF25029.1| 650|Anopheles gambiae tryptophan transpo... 23 9.2 >AY187042-1|AAO39756.1| 248|Anopheles gambiae putative antennal carrier protein TOL-2 protein. Length = 248 Score = 25.4 bits (53), Expect = 2.3 Identities = 15/54 (27%), Positives = 28/54 (51%) Frame = -1 Query: 347 ENGNFVTVNNKESILNLNTALKTAMGGIILEKINHIVKTDERVIYSDHLSSLFN 186 E + +T+ N + ++ N AL+ G ++N I T + + HL++LFN Sbjct: 138 EGTSNMTMVNCDFLMKWNGALEKRANGKEYYQMNKIKATFDTTRFYMHLTNLFN 191 >AY536865-1|AAT07965.1| 650|Anopheles gambiae tryptophan transporter protein. Length = 650 Score = 23.4 bits (48), Expect = 9.2 Identities = 7/20 (35%), Positives = 14/20 (70%) Frame = +1 Query: 64 VLERTWWWSVIQQIFYNLPI 123 +LE W++ + Q+F++L I Sbjct: 315 ILEAKVWYAAVTQVFFSLTI 334 >AJ626713-1|CAF25029.1| 650|Anopheles gambiae tryptophan transporter protein. Length = 650 Score = 23.4 bits (48), Expect = 9.2 Identities = 7/20 (35%), Positives = 14/20 (70%) Frame = +1 Query: 64 VLERTWWWSVIQQIFYNLPI 123 +LE W++ + Q+F++L I Sbjct: 315 ILEAKVWYAAVTQVFFSLTI 334 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 868,111 Number of Sequences: 2352 Number of extensions: 17617 Number of successful extensions: 29 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 93026475 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -