BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= MFBP02_F_E03
(903 letters)
Database: tribolium
336 sequences; 122,585 total letters
Searching.......................................................done
Score E
Sequences producing significant alignments: (bits) Value
DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 28 0.11
>DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome
adhesion molecule splicevariant 3.12.3.1 protein.
Length = 1639
Score = 27.9 bits (59), Expect = 0.11
Identities = 14/50 (28%), Positives = 27/50 (54%)
Frame = -2
Query: 413 SNGLKVARGLQLVDTMALGLAISGTLSNWTLAATTSHTDSEYNITLFSTV 264
+NG+ + R + V T+++ S + N+T A+ S + + Y +LF V
Sbjct: 648 TNGIVINRASKRVSTLSIDNVQSTHVGNYTCLASNSASVTTYTTSLFINV 697
Database: tribolium
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 122,585
Number of sequences in database: 336
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 123,288
Number of Sequences: 336
Number of extensions: 2320
Number of successful extensions: 4
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 122,585
effective HSP length: 57
effective length of database: 103,433
effective search space used: 25134219
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -