BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_E01 (900 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein ... 24 7.2 AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. 24 7.2 AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein ... 23 9.6 >AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein protein. Length = 596 Score = 23.8 bits (49), Expect = 7.2 Identities = 16/50 (32%), Positives = 24/50 (48%) Frame = +1 Query: 478 GDDGRPAYGDGKDKTSPRVSWKLIALWENNKVYFKILNTERNQYLVLGVG 627 GD GRPAY D + +V + ++Y L TE ++ L+ G G Sbjct: 104 GDGGRPAYSGNSDPSMDQVKTD-----KPRELYIPPLPTE-DESLIFGSG 147 >AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. Length = 786 Score = 23.8 bits (49), Expect = 7.2 Identities = 15/62 (24%), Positives = 27/62 (43%) Frame = +3 Query: 168 NDILEEQLYNSVVVADYDSAVEKSKHLYEEKKSEVITNVVNKLIRNNKMNCMEYAYQLWL 347 +D +EQ Y + D + + + +E K E TNV + I ++ + + W Sbjct: 565 DDESKEQTYGDPKIEDNPTESVEIEWSLDETKREAKTNVADDTISESEFYGWDCSDDGWP 624 Query: 348 QG 353 QG Sbjct: 625 QG 626 >AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein protein. Length = 814 Score = 23.4 bits (48), Expect = 9.6 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -2 Query: 92 SVESCVLPKNGTQKNLKGIP 33 S SC LP+ G + ++ G+P Sbjct: 446 SASSCFLPEAGARWDVSGVP 465 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 726,060 Number of Sequences: 2352 Number of extensions: 12925 Number of successful extensions: 102 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 101 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 102 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 97160985 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -