BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_E01 (900 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 23 3.8 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 22 8.8 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 23.0 bits (47), Expect = 3.8 Identities = 13/46 (28%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +1 Query: 547 IALWEN--NKVYFKILNTERNQYLVLGVGTNWNGXHMAFGVXSVDS 678 IA W + N++ L+TE+ + T W HM+ ++DS Sbjct: 177 IASWSHGSNEIKLNSLDTEQILDDMYNNNTEWEIVHMSHSESTIDS 222 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 21.8 bits (44), Expect = 8.8 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = +2 Query: 254 GEEERSHHKCREQTDTKQQDELHGV 328 GE S + RE ++ D+LH V Sbjct: 249 GERSCSRDRSREYKKDRRYDQLHNV 273 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 196,028 Number of Sequences: 438 Number of extensions: 3726 Number of successful extensions: 13 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 29146299 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -