BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_D24 (910 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF007192-1|AAC02270.1| 338|Homo sapiens intestinal mucin protein. 32 3.3 AF043724-1|AAC39862.1| 359|Homo sapiens hepatitis A virus cellu... 31 4.4 Z72496-1|CAA96577.1| 3570|Homo sapiens mucin MUC5B protein. 31 5.8 >AF007192-1|AAC02270.1| 338|Homo sapiens intestinal mucin protein. Length = 338 Score = 31.9 bits (69), Expect = 3.3 Identities = 17/56 (30%), Positives = 26/56 (46%) Frame = +3 Query: 135 WPTLKETATNLLTTARTSLILPKTTTLMETATNLSTTVHITWTVPKADLTSSLPLS 302 WPT T ++L T +S +P T TN++ + T+P +T S P S Sbjct: 179 WPTATNTLSSLTTNILSSTPVPSTERTTSHTTNINPVSTLVTTLP-TTITRSTPTS 233 >AF043724-1|AAC39862.1| 359|Homo sapiens hepatitis A virus cellular receptor 1 protein. Length = 359 Score = 31.5 bits (68), Expect = 4.4 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 3/51 (5%) Frame = +3 Query: 153 TATNLLTTARTSLILPKTTTLMETATNLSTTVHITWTVP---KADLTSSLP 296 T +TT RTS +P TTT+ T + ++ T TVP T+S+P Sbjct: 136 TTVPTVTTVRTSTTVPTTTTVPTTTVPTTMSIPTTTTVPTTMTVSTTTSVP 186 Score = 31.1 bits (67), Expect = 5.8 Identities = 19/58 (32%), Positives = 32/58 (55%) Frame = +3 Query: 141 TLKETATNLLTTARTSLILPKTTTLMETATNLSTTVHITWTVPKADLTSSLPLSLVLA 314 T+ T T TT T++ +P TTT+ T T +STT + T T+S+P++ ++ Sbjct: 149 TVPTTTTVPTTTVPTTMSIPTTTTVPTTMT-VSTTTSVP-TTTSIPTTTSVPVTTTVS 204 >Z72496-1|CAA96577.1| 3570|Homo sapiens mucin MUC5B protein. Length = 3570 Score = 31.1 bits (67), Expect = 5.8 Identities = 17/51 (33%), Positives = 26/51 (50%) Frame = +3 Query: 132 LWPTLKETATNLLTTARTSLILPKTTTLMETATNLSTTVHITWTVPKADLT 284 L +L T T+ L+T++ P+T T M TN +T+ T PK + T Sbjct: 417 LTTSLAPTLTSELSTSQAETSTPRTETTMSPLTNTTTSQGTTRCQPKCEWT 467 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 103,735,969 Number of Sequences: 237096 Number of extensions: 2395986 Number of successful extensions: 11980 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 11236 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11964 length of database: 76,859,062 effective HSP length: 90 effective length of database: 55,520,422 effective search space used: 11770329464 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -