BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_D23 (870 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1347.08c |||ribonuclease H2 complex subunit|Schizosaccharomy... 27 2.6 SPBC6B1.02 |ppk30||Ark1/Prk1 family protein kinase Ppk30|Schizos... 26 6.1 SPAC1002.14 |itt1||ubiquitin-protein ligase E3 |Schizosaccharomy... 26 6.1 >SPBC1347.08c |||ribonuclease H2 complex subunit|Schizosaccharomyces pombe|chr 2|||Manual Length = 293 Score = 27.5 bits (58), Expect = 2.6 Identities = 13/26 (50%), Positives = 17/26 (65%), Gaps = 2/26 (7%) Frame = +3 Query: 582 SKQRSAMIGDHL--NTYTIICCPICL 653 SKQRS +GDH+ + Y +C PI L Sbjct: 48 SKQRSWFVGDHVVSDGYLYVCTPIDL 73 >SPBC6B1.02 |ppk30||Ark1/Prk1 family protein kinase Ppk30|Schizosaccharomyces pombe|chr 2|||Manual Length = 953 Score = 26.2 bits (55), Expect = 6.1 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +3 Query: 495 VCGIWIRTPTFLPVVWSRRSSVTKDQTSD 581 + G+ IR F P V S +S + KDQ+S+ Sbjct: 635 MAGLDIRKEPFTPAVPSAKSGLKKDQSSE 663 >SPAC1002.14 |itt1||ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 435 Score = 26.2 bits (55), Expect = 6.1 Identities = 12/38 (31%), Positives = 16/38 (42%) Frame = -1 Query: 531 AEKWVFLSRSHTPEPDAVIPDLPPICLFRSIVAXAFXF 418 AEKWV L+ P D V+ + C + F F Sbjct: 357 AEKWVLLNGQRCPTCDRVVERIDGCCHMNCLCGTHFCF 394 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,276,794 Number of Sequences: 5004 Number of extensions: 39872 Number of successful extensions: 80 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 77 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 80 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 434475230 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -