BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_D23 (870 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_44684| Best HMM Match : Synaphin (HMM E-Value=7.5) 28 8.6 SB_8467| Best HMM Match : rve (HMM E-Value=2.4e-13) 28 8.6 >SB_44684| Best HMM Match : Synaphin (HMM E-Value=7.5) Length = 141 Score = 28.3 bits (60), Expect = 8.6 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +2 Query: 509 DKNTHFSAGGMVSKEFGHKRPDVGLQAEIRHD 604 + + F G ++ +EFGHKRP +A D Sbjct: 64 EMDEEFGIGELIHEEFGHKRPSSSRKAYTSRD 95 >SB_8467| Best HMM Match : rve (HMM E-Value=2.4e-13) Length = 347 Score = 28.3 bits (60), Expect = 8.6 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -1 Query: 510 SRSHTPEPDAVIPDLPPICLFRSIVAXAFXF 418 +R H PEP +P PP F ++ A F + Sbjct: 10 TRRHRPEPPPPLPTAPPSTPFEAVFADFFDY 40 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,949,860 Number of Sequences: 59808 Number of extensions: 345076 Number of successful extensions: 1006 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 902 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1006 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2491217872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -