BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_D22 (952 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_22077| Best HMM Match : MIP (HMM E-Value=0) 50 3e-06 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 36 0.048 SB_22076| Best HMM Match : MIP (HMM E-Value=3.89981e-42) 34 0.15 SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_46036| Best HMM Match : PSRT (HMM E-Value=1) 32 0.78 SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) 32 0.78 SB_33719| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 31 1.8 SB_53865| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_55889| Best HMM Match : REJ (HMM E-Value=5.4e-07) 30 2.4 SB_51825| Best HMM Match : 7tm_1 (HMM E-Value=3.8e-08) 30 2.4 SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 30 2.4 SB_48525| Best HMM Match : Glyco_hydro_18 (HMM E-Value=0) 30 3.2 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 29 4.2 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_41742| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_24403| Best HMM Match : BRF1 (HMM E-Value=1.2) 29 5.5 SB_23053| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) 29 5.5 SB_42616| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.3 SB_17543| Best HMM Match : Keratin_B2 (HMM E-Value=1.9) 29 7.3 SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) 29 7.3 SB_3531| Best HMM Match : Cytomega_US3 (HMM E-Value=6.7) 29 7.3 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 29 7.3 SB_49641| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.3 SB_12127| Best HMM Match : Endonuclease_NS (HMM E-Value=2.9e-35) 29 7.3 SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.3 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 SB_46179| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 SB_3524| Best HMM Match : ETS_PEA3_N (HMM E-Value=5.8) 28 9.6 SB_49341| Best HMM Match : Rad21_Rec8_N (HMM E-Value=2.3) 28 9.6 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 28 9.6 SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) 28 9.6 SB_28143| Best HMM Match : Neur_chan_memb (HMM E-Value=2.2) 28 9.6 >SB_22077| Best HMM Match : MIP (HMM E-Value=0) Length = 374 Score = 50.0 bits (114), Expect = 3e-06 Identities = 27/86 (31%), Positives = 43/86 (50%) Frame = +1 Query: 157 WWRALVSELLATAFLVWLGVSSVVPYKGKEAVVLSHPAFAFGFVVLGNAMAFGPTSGAHM 336 +W ++ +E LAT F V++ S + + + + H A G + AMA G SG H+ Sbjct: 46 FWVSVFAEFLATFFFVFMVCGSCLLWDKNDPPAVQHIALCAGLGIATWAMAVGHWSGGHI 105 Query: 337 NPAVTLAAALQGRMSPALAAAYTVAQ 414 NPAVT+ +++ Y VAQ Sbjct: 106 NPAVTVGFLSSNKIAILQGVCYIVAQ 131 Score = 33.9 bits (74), Expect = 0.19 Identities = 21/65 (32%), Positives = 30/65 (46%) Frame = +1 Query: 322 SGAHMNPAVTLAAALQGRMSPALAAAYTVAQVXXXXXXXXXXXXVTPASALGTDEGCTLX 501 SG H+NPAVT++ + ++S A Y + QV +TP GT G T+ Sbjct: 194 SGGHINPAVTISFMIVRKVSFLRGAFYVIGQVGGGIAGSAMLYGLTPVDKRGT-LGATVP 252 Query: 502 ARDVS 516 VS Sbjct: 253 NAGVS 257 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 38.7 bits (86), Expect = 0.007 Identities = 17/52 (32%), Positives = 24/52 (46%) Frame = +2 Query: 797 WAPXRXXPXPSFPPXPXXTPTPPXXXPXXXPPSRFNHLPXXHLPPXXXPPHS 952 ++P P P +PP P P PP P PP + P + PP PP++ Sbjct: 88 FSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPN-PPYPPPPNA 138 Score = 35.5 bits (78), Expect = 0.064 Identities = 18/52 (34%), Positives = 21/52 (40%) Frame = +2 Query: 791 PXWAPXRXXPXPSFPPXPXXTPTPPXXXPXXXPPSRFNHLPXXHLPPXXXPP 946 P AP P P +PP P P PP PP + P + PP PP Sbjct: 119 PPNAPYPPPPNPPYPP-PPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPP 169 Score = 34.7 bits (76), Expect = 0.11 Identities = 17/50 (34%), Positives = 21/50 (42%) Frame = +2 Query: 803 PXRXXPXPSFPPXPXXTPTPPXXXPXXXPPSRFNHLPXXHLPPXXXPPHS 952 P P P +PP P PP P PP+ N P PP PP++ Sbjct: 170 PNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPN--PPYPPPPNA 217 Score = 34.3 bits (75), Expect = 0.15 Identities = 17/54 (31%), Positives = 21/54 (38%), Gaps = 1/54 (1%) Frame = +2 Query: 791 PXWAPXRXXPXPSFPPXPXXTPTPPXXXPXXXPPSR-FNHLPXXHLPPXXXPPH 949 P P P P +PP P PP P PP+ + P PP PP+ Sbjct: 103 PPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPY 156 Score = 34.3 bits (75), Expect = 0.15 Identities = 17/53 (32%), Positives = 19/53 (35%) Frame = +2 Query: 791 PXWAPXRXXPXPSFPPXPXXTPTPPXXXPXXXPPSRFNHLPXXHLPPXXXPPH 949 P AP P +PP P PP P PP P PP PP+ Sbjct: 135 PPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPY 187 Score = 33.5 bits (73), Expect = 0.26 Identities = 17/53 (32%), Positives = 20/53 (37%) Frame = +2 Query: 791 PXWAPXRXXPXPSFPPXPXXTPTPPXXXPXXXPPSRFNHLPXXHLPPXXXPPH 949 P P P P +PP P P PP P PP + P P PP+ Sbjct: 182 PPNPPYPPPPNPPYPP-PPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPY 233 Score = 33.1 bits (72), Expect = 0.34 Identities = 17/50 (34%), Positives = 20/50 (40%), Gaps = 1/50 (2%) Frame = +2 Query: 803 PXRXXPXPSFPPXPXXT-PTPPXXXPXXXPPSRFNHLPXXHLPPXXXPPH 949 P P P +PP P P PP P PP + P PP PP+ Sbjct: 85 PTNFSPNPPYPPPPYPPYPPPPPYPPPPNPP--YPPPPNAPYPPPPNPPY 132 Score = 32.3 bits (70), Expect = 0.59 Identities = 16/51 (31%), Positives = 21/51 (41%), Gaps = 1/51 (1%) Frame = +2 Query: 803 PXRXXPXPSFPPXPXXTPTPPXXXPXXXPPS-RFNHLPXXHLPPXXXPPHS 952 P P P +PP P PP P PP+ + P PP PP++ Sbjct: 178 PYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNA 228 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/52 (30%), Positives = 17/52 (32%) Frame = +2 Query: 791 PXWAPXRXXPXPSFPPXPXXTPTPPXXXPXXXPPSRFNHLPXXHLPPXXXPP 946 P + P P P P P P P P PP P PP PP Sbjct: 130 PPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPP 181 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/50 (30%), Positives = 18/50 (36%) Frame = +2 Query: 800 APXRXXPXPSFPPXPXXTPTPPXXXPXXXPPSRFNHLPXXHLPPXXXPPH 949 AP P P +PP P P PP + P PP PP+ Sbjct: 146 APYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPY 195 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/50 (30%), Positives = 18/50 (36%) Frame = +2 Query: 803 PXRXXPXPSFPPXPXXTPTPPXXXPXXXPPSRFNHLPXXHLPPXXXPPHS 952 P P P +PP P P P PP P PP PP++ Sbjct: 152 PNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNA 201 Score = 29.5 bits (63), Expect = 4.2 Identities = 15/53 (28%), Positives = 19/53 (35%) Frame = +2 Query: 791 PXWAPXRXXPXPSFPPXPXXTPTPPXXXPXXXPPSRFNHLPXXHLPPXXXPPH 949 P + P P P+ P P P PP P + P PP PP+ Sbjct: 159 PLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPY 211 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 35.9 bits (79), Expect = 0.048 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = +2 Query: 791 PXWAPXRXXPXPSFPPXPXXTPTPPXXXPXXXPPSRFNHLPXXHLPPXXXPP 946 P P P P PP P P PP P PP P PP PP Sbjct: 375 PPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPP 426 Score = 35.9 bits (79), Expect = 0.048 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = +2 Query: 791 PXWAPXRXXPXPSFPPXPXXTPTPPXXXPXXXPPSRFNHLPXXHLPPXXXPP 946 P P P PS PP P P PP P PP P PP PP Sbjct: 376 PSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Score = 34.3 bits (75), Expect = 0.15 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = +2 Query: 818 PXPSFPPXPXXTPTPPXXXPXXXPPSRFNHLPXXHLPPXXXPP 946 P P PP P +P PP P PP P PP PP Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPP 408 Score = 34.3 bits (75), Expect = 0.15 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = +2 Query: 788 APXWAPXRXXPXPSFPPXPXXTPTPPXXXPXXXPPSRFNHLPXXHLPPXXXPP 946 +P P P P PP P P PP P PP P PP PP Sbjct: 377 SPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 34.3 bits (75), Expect = 0.15 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = +2 Query: 791 PXWAPXRXXPXPSFPPXPXXTPTPPXXXPXXXPPSRFNHLPXXHLPPXXXPP 946 P P P P PP P P PP P PP P PP PP Sbjct: 381 PPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 33.9 bits (74), Expect = 0.19 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = +2 Query: 818 PXPSFPPXPXXTPTPPXXXPXXXPPSRFNHLPXXHLPPXXXPP 946 P P PP P P PP P PP + P PP PP Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPP 410 Score = 33.9 bits (74), Expect = 0.19 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = +2 Query: 791 PXWAPXRXXPXPSFPPXPXXTPTPPXXXPXXXPPSRFNHLPXXHLPPXXXPP 946 P P P P PP P P PP P PP P PP PP Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPP 423 Score = 33.1 bits (72), Expect = 0.34 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = +2 Query: 788 APXWAPXRXXPXPSFPPXPXXTPTPPXXXPXXXPPSRFNHLPXXHLPPXXXPP 946 +P P P PS PP P P P P PP P PP PP Sbjct: 364 SPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPP 416 Score = 31.5 bits (68), Expect = 1.0 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = +2 Query: 791 PXWAPXRXXPXPSFPPXPXXTPTPPXXXPXXXPPSRFNHLPXXHLPPXXXPP 946 P P P P P P P PP P PP P PP PP Sbjct: 380 PPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Score = 30.7 bits (66), Expect = 1.8 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = +2 Query: 791 PXWAPXRXXPXPSFPPXPXXTPTPPXXXPXXXPPSRFNHLPXXHLPPXXXPP 946 P P P P PP P PP P PP P PP PP Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 30.7 bits (66), Expect = 1.8 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = +2 Query: 791 PXWAPXRXXPXPSFPPXPXXTPTPPXXXPXXXPPSRFNHLPXXHLPPXXXPP 946 P P P P PP P P P P PP P PP PP Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPP 421 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +2 Query: 791 PXWAPXRXXPXPSFPPXPXXTPTPPXXXPXXXPPS 895 P P P P PP P P PP P PP+ Sbjct: 399 PPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPA 433 >SB_22076| Best HMM Match : MIP (HMM E-Value=3.89981e-42) Length = 365 Score = 34.3 bits (75), Expect = 0.15 Identities = 22/89 (24%), Positives = 37/89 (41%) Frame = +1 Query: 151 RRWWRALVSELLATAFLVWLGVSSVVPYKGKEAVVLSHPAFAFGFVVLGNAMAFGPTSGA 330 RR+W +++E + T+ V + V L+H A G AM S Sbjct: 14 RRFWTEILAEFIITSLFVSI-VCGTALQNWSTPPTLTHMALNSGLAAGTFAMCMWDVSSG 72 Query: 331 HMNPAVTLAAALQGRMSPALAAAYTVAQV 417 NPA+T+ + G+ + Y +AQ+ Sbjct: 73 LFNPALTIGFLITGKKTLLQTIFYIMAQL 101 >SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1212 Score = 33.1 bits (72), Expect = 0.34 Identities = 16/52 (30%), Positives = 20/52 (38%) Frame = +2 Query: 791 PXWAPXRXXPXPSFPPXPXXTPTPPXXXPXXXPPSRFNHLPXXHLPPXXXPP 946 P P + P PS P P P PP PP + + +P P PP Sbjct: 1055 PIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPPPRQPDPIPTNPAHPTEPPP 1106 Score = 29.1 bits (62), Expect = 5.5 Identities = 16/49 (32%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = +2 Query: 803 PXRXXPXPSFPPXPXX-TPTPPXXXPXXXPPSRFNHLPXXHLPPXXXPP 946 P R PS P P P+PP PP + + P PP PP Sbjct: 1029 PKRKASPPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPP 1077 >SB_46036| Best HMM Match : PSRT (HMM E-Value=1) Length = 878 Score = 31.9 bits (69), Expect = 0.78 Identities = 23/72 (31%), Positives = 32/72 (44%), Gaps = 3/72 (4%) Frame = -2 Query: 231 RHHGADAEPHEERRGQQLGDQRSPPSP---HPAGQTARRIFVCGGHVERARACRCGRSEC 61 RH E E G+ + ++RSP P P + ARR ERA + RSE Sbjct: 129 RHSKKGKERKGELPGRSMEEERSPEPPAREEPRRENARRRKDSSSENERANKPKTRRSET 188 Query: 60 RRRTQNLKNSTS 25 R Q+ + S+S Sbjct: 189 RSSRQSNQRSSS 200 >SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) Length = 293 Score = 31.9 bits (69), Expect = 0.78 Identities = 19/67 (28%), Positives = 23/67 (34%), Gaps = 1/67 (1%) Frame = +2 Query: 749 HSGHXXPXXXRXXAPXWAPXRXXPXPSFPPXPXXT-PTPPXXXPXXXPPSRFNHLPXXHL 925 + G P A + P P S+PP P P P P PP + P Sbjct: 131 YPGAAGPPMPHPTASVYPPPGGYPPTSYPPQPYPAQPYPQQGYPPQPPPQAY---PQPGY 187 Query: 926 PPXXXPP 946 PP PP Sbjct: 188 PPQGYPP 194 Score = 29.1 bits (62), Expect = 5.5 Identities = 13/43 (30%), Positives = 16/43 (37%) Frame = +2 Query: 818 PXPSFPPXPXXTPTPPXXXPXXXPPSRFNHLPXXHLPPXXXPP 946 P P + P P P P P P+ + P PP PP Sbjct: 118 PPPPYSPIPPQVPYPGAAGPPMPHPTASVYPPPGGYPPTSYPP 160 >SB_33719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 31.1 bits (67), Expect = 1.4 Identities = 19/85 (22%), Positives = 36/85 (42%) Frame = +1 Query: 160 WRALVSELLATAFLVWLGVSSVVPYKGKEAVVLSHPAFAFGFVVLGNAMAFGPTSGAHMN 339 W + +E L T ++ ++ + ++G + + A F + + H N Sbjct: 16 WICVFAEYLGTLLFMFSVSAASLRWEGTPSTLEIALAAGFSMATVTQVFRWVSRPLVHAN 75 Query: 340 PAVTLAAALQGRMSPALAAAYTVAQ 414 PAVT+A+ L G S + Y + Q Sbjct: 76 PAVTVASFLAGDTSLVASFLYVIVQ 100 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +2 Query: 809 RXXPXPSFPPXPXXTPTPPXXXPXXXPPSRFNHLPXXHLPPXXXP 943 R P P PP P P PP P P S P P P Sbjct: 859 RPRPRPRRPPPPPPPPPPPPPPPPPPPASSTGSTPGGDKVPSVGP 903 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 30.7 bits (66), Expect = 1.8 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = +2 Query: 818 PXPSFPPXPXXTPTPPXXXPXXXPPSRFNHLPXXHLPPXXXP 943 P P PP P PTPP P P H+P L P P Sbjct: 192 PAPPSPPIPTAPPTPP--MPETPLPPGSPHIPPAPLHPHIPP 231 >SB_53865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 919 Score = 30.3 bits (65), Expect = 2.4 Identities = 20/67 (29%), Positives = 20/67 (29%), Gaps = 1/67 (1%) Frame = +2 Query: 749 HSGHXXPXXXRXXAPXWAPXRXXPXPSFPPXPXXTPTPPXXXP-XXXPPSRFNHLPXXHL 925 H G AP P R P P PP P P P PP FN Sbjct: 261 HEGDPYHGGPFNQAPPGFPPRWGPPPHMPPDYRGFPPPNFPPPDFSRPPPNFNDPAFQGR 320 Query: 926 PPXXXPP 946 PP P Sbjct: 321 PPPFVRP 327 >SB_55889| Best HMM Match : REJ (HMM E-Value=5.4e-07) Length = 2008 Score = 30.3 bits (65), Expect = 2.4 Identities = 19/60 (31%), Positives = 30/60 (50%) Frame = +1 Query: 307 AFGPTSGAHMNPAVTLAAALQGRMSPALAAAYTVAQVXXXXXXXXXXXXVTPASALGTDE 486 A+G +S A++N VT A +S LAAA T++ +T +SAL ++E Sbjct: 1234 AYGSSSFANLNITVTAPADPSAAVSSVLAAASTLSDSGDPTQAVSSLAMLTGSSALASEE 1293 >SB_51825| Best HMM Match : 7tm_1 (HMM E-Value=3.8e-08) Length = 364 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/40 (35%), Positives = 24/40 (60%) Frame = +1 Query: 178 ELLATAFLVWLGVSSVVPYKGKEAVVLSHPAFAFGFVVLG 297 ++LA A++V +GVS + G L+H F FG +++G Sbjct: 114 KILAFAWIVPIGVSLIPLAYGTNVDTLAHQIFLFGILIVG 153 >SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -3 Query: 944 GXGXRGXGGXXGGG*XGRGGXXXGXG 867 G G RG GG GGG RGG G G Sbjct: 756 GGGYRGGGGYGGGGGGYRGGGGYGGG 781 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 30.3 bits (65), Expect = 2.4 Identities = 21/60 (35%), Positives = 25/60 (41%), Gaps = 8/60 (13%) Frame = +2 Query: 791 PXWAPXRXXPXPSFPPXPXXTPTPPXXXPXXXPPSRFNHL--------PXXHLPPXXXPP 946 P P R P P PP P +P+PP P PPS L P ++PP PP Sbjct: 204 PPPPPPRPPPSPP-PPPPPPSPSPP-RPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLPPP 261 Score = 28.3 bits (60), Expect = 9.6 Identities = 11/31 (35%), Positives = 14/31 (45%) Frame = +2 Query: 800 APXRXXPXPSFPPXPXXTPTPPXXXPXXXPP 892 +P + P PP P +P PP P PP Sbjct: 197 SPSQITQPPPPPPRPPPSPPPPPPPPSPSPP 227 >SB_48525| Best HMM Match : Glyco_hydro_18 (HMM E-Value=0) Length = 569 Score = 29.9 bits (64), Expect = 3.2 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = -2 Query: 174 DQRSPPSPHPAGQTARRIFVCGGHVERARACRCGRS 67 DQR PP H A QT RI G +E A R ++ Sbjct: 113 DQRCPPGHHQAVQTPVRIKQTGKRIENIAASRSNKT 148 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +2 Query: 818 PXPSFPPXPXXTPTPPXXXPXXXPP 892 P P PP P +P+PP P PP Sbjct: 1159 PPPPPPPPPPSSPSPPPPPPPPPPP 1183 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 29.5 bits (63), Expect = 4.2 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +2 Query: 803 PXRXXPXPSFPPXPXXTPTPPXXXPXXXPPS 895 P P P PP P P PP P PP+ Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPPPPPT 495 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 29.5 bits (63), Expect = 4.2 Identities = 16/53 (30%), Positives = 17/53 (32%) Frame = +2 Query: 788 APXWAPXRXXPXPSFPPXPXXTPTPPXXXPXXXPPSRFNHLPXXHLPPXXXPP 946 AP P P PP P + PP PP P PP PP Sbjct: 941 APSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPPP 993 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 29.5 bits (63), Expect = 4.2 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +2 Query: 824 PSFPPXPXXTPTPPXXXPXXXPPSRFNHLPXXHLPPXXXPP 946 PS PP TP PP PP + P PP PP Sbjct: 355 PSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPP 395 Score = 28.3 bits (60), Expect = 9.6 Identities = 18/60 (30%), Positives = 18/60 (30%) Frame = +2 Query: 767 PXXXRXXAPXWAPXRXXPXPSFPPXPXXTPTPPXXXPXXXPPSRFNHLPXXHLPPXXXPP 946 P P P P P PP P PP PP N P PP PP Sbjct: 357 PPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNG-PPPPPPPTNGPP 415 >SB_41742| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1061 Score = 29.1 bits (62), Expect = 5.5 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 240 PFVRHHGADAEPHEERRGQQLGD 172 P VRHH A H ERR LGD Sbjct: 697 PAVRHHKAAEGSHTERRAVHLGD 719 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +2 Query: 818 PXPSFPPXPXXTPTPPXXXPXXXPPSRFNHLP 913 P P FP P PP P P RF + P Sbjct: 427 PPPGFPQFQPPPPPPPSDAPWIERPKRFENNP 458 >SB_24403| Best HMM Match : BRF1 (HMM E-Value=1.2) Length = 623 Score = 29.1 bits (62), Expect = 5.5 Identities = 22/81 (27%), Positives = 39/81 (48%) Frame = -3 Query: 377 MRPCSAAASVTAGFMCAPDVGPNAIALPSTTNPKAKAGCDSTTASFPLYGTTELTPSHTR 198 MR + A+ TA +P V P + S+T A + S +SFP +G+T + Sbjct: 505 MRTGNQASVYTASSQSSP-VRPTPVRANSSTG--ASSSSPSGYSSFPAHGSTGPNKACLS 561 Query: 197 NAVASSSETSARHHRRTQPDK 135 A+++ + +A+ R Q +K Sbjct: 562 QAMSAGKQAAAKMALRKQLEK 582 >SB_23053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 497 Score = 29.1 bits (62), Expect = 5.5 Identities = 21/72 (29%), Positives = 31/72 (43%), Gaps = 2/72 (2%) Frame = -3 Query: 329 APDVGPNAIALPSTTNPKAKAGCDSTTASFPLYGTTELTPSHTRNAVASSSETSARH--H 156 APD + + L T P G TA +G ++ T H ++ S+ H Sbjct: 332 APD---HPLGLSKRTAPDHTLGVSKRTAPDHPHGLSKRTAPHHPLGLSKSTAPDHPHGVS 388 Query: 155 RRTQPDKPRGVS 120 +RT PD P G+S Sbjct: 389 KRTAPDHPHGLS 400 >SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) Length = 496 Score = 29.1 bits (62), Expect = 5.5 Identities = 19/56 (33%), Positives = 22/56 (39%), Gaps = 2/56 (3%) Frame = +2 Query: 791 PXWAPXRXXPXPSFPPXPXXTPTPPXXXPXXXPPSRFNHLPXXHLP-PXXXPP-HS 952 P P P +PP P P P P P R+ P +LP P PP HS Sbjct: 335 PPSPPRYPSSHPRYPPSPPRYPPSPPRYPSSHP--RYPPSPLRYLPSPIRYPPSHS 388 >SB_42616| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 512 Score = 28.7 bits (61), Expect = 7.3 Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = -2 Query: 207 PHEERRGQQLGDQRSPPSPHPAGQTARRIFVCGGHVER-ARACRCGRSECRRRT 49 P ++R + D+ +PP+ Q RIFV ++ + ACR G S R RT Sbjct: 357 PAVKQRAAEGTDEVTPPTLRVYAQQGSRIFVSMHSKDQGSTACRSGDSASRSRT 410 >SB_17543| Best HMM Match : Keratin_B2 (HMM E-Value=1.9) Length = 229 Score = 28.7 bits (61), Expect = 7.3 Identities = 15/41 (36%), Positives = 19/41 (46%), Gaps = 2/41 (4%) Frame = -1 Query: 355 PASRPG--SCAHPTSARTPSHCRAPQTRKQKRDVTARRPPS 239 P RP +C P +A T C +P T R V + PPS Sbjct: 102 PCHRPTCKTCTSPVTALTCKTCTSPDTALHARRVLSLSPPS 142 >SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) Length = 315 Score = 28.7 bits (61), Expect = 7.3 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 3/50 (6%) Frame = +2 Query: 803 PXRXXPXPSFPPXPXXT---PTPPXXXPXXXPPSRFNHLPXXHLPPXXXP 943 P R P P FP P T P PP P PP P PP P Sbjct: 163 PPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIPP 212 >SB_3531| Best HMM Match : Cytomega_US3 (HMM E-Value=6.7) Length = 519 Score = 28.7 bits (61), Expect = 7.3 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +3 Query: 216 QLRGAVQREGGRRAVTSRFCFRVCGARQCDG 308 +LRG Q+ GG+R + FR G Q DG Sbjct: 457 ELRGEGQQNGGKRRRQGKVAFRRSGLLQADG 487 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 28.7 bits (61), Expect = 7.3 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -3 Query: 950 SEGXGXRGXGGXXGGG*XGRGGXXXGXG 867 S+G G R GG GG G GG G G Sbjct: 183 SQGGGYRSGGGGYGGSKGGYGGGSGGGG 210 >SB_49641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 755 Score = 28.7 bits (61), Expect = 7.3 Identities = 21/68 (30%), Positives = 32/68 (47%), Gaps = 1/68 (1%) Frame = -3 Query: 365 SAAASVTAGFMCAPDVGPNAIALPSTTNPKA-KAGCDSTTASFPLYGTTELTPSHTRNAV 189 S S AG A PN+ + ST + +A TTA+ GTTE S + + Sbjct: 270 STKTSTRAGLTKAATTSPNSSSSLSTGKARTTEATTTGTTAATATTGTTEALSSQSVISN 329 Query: 188 ASSSETSA 165 AS++ T++ Sbjct: 330 ASTTSTTS 337 >SB_12127| Best HMM Match : Endonuclease_NS (HMM E-Value=2.9e-35) Length = 1577 Score = 28.7 bits (61), Expect = 7.3 Identities = 19/47 (40%), Positives = 22/47 (46%), Gaps = 4/47 (8%) Frame = +3 Query: 252 RAVTSRFCFRVCGARQCDGVRA---DVG-CAHEPGRDAGCRAAGPHV 380 RA R C R C +RQ + DV CA+EP A C GP V Sbjct: 634 RATADRICER-CSSRQTKTIGTGDYDVSDCANEPRTTADCYIRGPKV 679 >SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 28.7 bits (61), Expect = 7.3 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +2 Query: 800 APXRXXPXPSFPPXPXXTPTPPXXXPXXXPPSRFN 904 AP P PP P + PP P PSR N Sbjct: 789 APAPFSAAPHLPPAPNISAEPPPPPPVARKPSRSN 823 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 28.3 bits (60), Expect = 9.6 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 818 PXPSFPPXPXXTPTPPXXXPXXXPP 892 P P PP P P PP P PP Sbjct: 684 PPPPPPPPPPPPPPPPPPQPSTPPP 708 >SB_46179| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4856 Score = 28.3 bits (60), Expect = 9.6 Identities = 16/49 (32%), Positives = 16/49 (32%), Gaps = 2/49 (4%) Frame = +2 Query: 803 PXRXXPXPSFPPXPXXTPTPPXXXP--XXXPPSRFNHLPXXHLPPXXXP 943 P R P P P P TPP P PP P PP P Sbjct: 616 PSRVPPQPETAPKPFPNITPPEVRPSLPGTPPETKTKPPLAPYPPKTSP 664 >SB_3524| Best HMM Match : ETS_PEA3_N (HMM E-Value=5.8) Length = 357 Score = 28.3 bits (60), Expect = 9.6 Identities = 19/61 (31%), Positives = 27/61 (44%), Gaps = 1/61 (1%) Frame = -3 Query: 308 AIALPSTTNPKAKAGCDSTTAS-FPLYGTTELTPSHTRNAVASSSETSARHHRRTQPDKP 132 + ALP NP GC + F G T + S RN ++ + HHRR ++P Sbjct: 266 SFALPDNANP----GCYPWSKQIFRHEGPTHIRTSVHRNVGDAAEQDYKDHHRRRSHNRP 321 Query: 131 R 129 R Sbjct: 322 R 322 >SB_49341| Best HMM Match : Rad21_Rec8_N (HMM E-Value=2.3) Length = 549 Score = 28.3 bits (60), Expect = 9.6 Identities = 16/45 (35%), Positives = 19/45 (42%), Gaps = 5/45 (11%) Frame = +2 Query: 833 PPXPXXTPTPPXXXPXXXPP-SRFNHLP----XXHLPPXXXPPHS 952 PP + TPP P PP S +H P H PP P H+ Sbjct: 382 PPVSTPSHTPPVSTPSHTPPVSTPSHTPPVSTPSHTPPVSTPSHT 426 Score = 28.3 bits (60), Expect = 9.6 Identities = 16/45 (35%), Positives = 19/45 (42%), Gaps = 5/45 (11%) Frame = +2 Query: 833 PPXPXXTPTPPXXXPXXXPP-SRFNHLP----XXHLPPXXXPPHS 952 PP + TPP P PP S +H P H PP P H+ Sbjct: 436 PPVSTPSHTPPVSTPSHTPPVSTPSHTPPVSTPSHTPPVSTPSHT 480 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 28.3 bits (60), Expect = 9.6 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +2 Query: 854 PTPPXXXPXXXPPSRFNHLPXXHLPPXXXPP 946 PTPP PP +P LPP PP Sbjct: 949 PTPPPPTSALPPPIPATQVPPPPLPPLPPPP 979 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 28.3 bits (60), Expect = 9.6 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = +2 Query: 824 PSFPPXPXXTPTPPXXXPXXXPPSRFNHLPXXHLPPXXXPP 946 P PP P P PP PPS + P P PP Sbjct: 364 PPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPP 404 >SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) Length = 667 Score = 28.3 bits (60), Expect = 9.6 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +2 Query: 818 PXPSFPPXPXXTPTPPXXXPXXXPP 892 P P+ PP P TP P P PP Sbjct: 430 PPPTPPPTPPPTPPPTTLPPTTQPP 454 >SB_28143| Best HMM Match : Neur_chan_memb (HMM E-Value=2.2) Length = 356 Score = 28.3 bits (60), Expect = 9.6 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = -3 Query: 581 ATRQTASTGREGRXPXXPRPARDTSLAXSVQPSSVPR 471 A+R T TGR+G P P P + + +P PR Sbjct: 144 ASRDTVRTGRDGHKPQAPNPTQSRDRSRE-RPRDQPR 179 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,365,678 Number of Sequences: 59808 Number of extensions: 374057 Number of successful extensions: 2595 Number of sequences better than 10.0: 41 Number of HSP's better than 10.0 without gapping: 1669 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2330 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2788625034 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -