BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_D19 (902 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090823-1|BAC57921.1| 429|Anopheles gambiae gag-like protein p... 26 1.4 AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 24 7.3 M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 23 9.6 AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein ... 23 9.6 AF487534-1|AAL93295.1| 509|Anopheles gambiae cytochrome P450 CY... 23 9.6 >AB090823-1|BAC57921.1| 429|Anopheles gambiae gag-like protein protein. Length = 429 Score = 26.2 bits (55), Expect = 1.4 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = +1 Query: 490 DAMIGYVLLNIGIVEMDTEEPTASEKSLNEAVDLLLE 600 +A I V+ +G + + +P ASE+ L EAVD L+ Sbjct: 269 NAGIARVITEMGEILITHIDPLASEEDLKEAVDRKLQ 305 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 23.8 bits (49), Expect = 7.3 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +3 Query: 462 GSPXR*YQTRCYDRICFVEHW 524 GS + YQ C DR CF E W Sbjct: 454 GSFRQVYQ-ECLDRSCFPEQW 473 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 23.4 bits (48), Expect = 9.6 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -2 Query: 259 NFNQYLYAALQHRLYD 212 NF + YAA HRLY+ Sbjct: 362 NFRLFKYAASAHRLYN 377 >AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein protein. Length = 814 Score = 23.4 bits (48), Expect = 9.6 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = +1 Query: 349 YLTKTARMILKMHHIFLSTK 408 + ++TAR +L +IFL+TK Sbjct: 97 FTSRTARSLLAQFNIFLTTK 116 >AF487534-1|AAL93295.1| 509|Anopheles gambiae cytochrome P450 CYP6P3 protein. Length = 509 Score = 23.4 bits (48), Expect = 9.6 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = +1 Query: 589 LLLENALKPEIVVTLINVYXNIGILWSNRDDP 684 L+++ L I+V NV+ + G+ + +DDP Sbjct: 86 LVIDPELAKTILVKDFNVFHDHGVFTNAKDDP 117 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 742,601 Number of Sequences: 2352 Number of extensions: 12631 Number of successful extensions: 68 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 68 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 68 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 97574436 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -