BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_D18 (887 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC4F6.04 |rpl2502|rpl25b, rpl23a-2|60S ribosomal protein L25|S... 43 5e-05 SPBC106.18 |rpl2501|rpl25a|60S ribosomal protein L25|Schizosacch... 42 2e-04 >SPBC4F6.04 |rpl2502|rpl25b, rpl23a-2|60S ribosomal protein L25|Schizosaccharomyces pombe|chr 2|||Manual Length = 141 Score = 43.2 bits (97), Expect = 5e-05 Identities = 22/43 (51%), Positives = 24/43 (55%) Frame = +2 Query: 713 VTKALKAQRKVVXGXHGKRVRKIXXSVHFRRPKTFEPPXHPKY 841 V KA AQ+ V G H K RK+ S FRRPKT E PKY Sbjct: 3 VGKAKGAQKTVQKGIHNKVARKVRTSTTFRRPKTLELARKPKY 45 >SPBC106.18 |rpl2501|rpl25a|60S ribosomal protein L25|Schizosaccharomyces pombe|chr 2|||Manual Length = 141 Score = 41.5 bits (93), Expect = 2e-04 Identities = 20/43 (46%), Positives = 24/43 (55%) Frame = +2 Query: 713 VTKALKAQRKVVXGXHGKRVRKIXXSVHFRRPKTFEPPXHPKY 841 V KA AQ+ V G H K +K+ S FRRPKT + PKY Sbjct: 3 VAKAKGAQKTVQKGIHNKVAKKVRTSTTFRRPKTLQLSRKPKY 45 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,598,599 Number of Sequences: 5004 Number of extensions: 19225 Number of successful extensions: 40 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 40 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 40 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 446488370 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -