BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_D18 (887 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_0407 - 24983491-24983575,24983655-24984015,24984367-249844... 40 0.002 01_03_0217 + 13879259-13879270,13880322-13880683,13880771-13880855 38 0.014 >04_04_0407 - 24983491-24983575,24983655-24984015,24984367-24984406, 24984466-24984468 Length = 162 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/42 (47%), Positives = 24/42 (57%) Frame = +2 Query: 719 KALKAQRKVVXGXHGKRVRKIXXSVHFRRPKTFEPPXHPKYP 844 +ALKA + V G K +KI SV F RPKT + PKYP Sbjct: 26 QALKAAKAVKSGTAKKTTKKIRTSVTFHRPKTLKKSRDPKYP 67 >01_03_0217 + 13879259-13879270,13880322-13880683,13880771-13880855 Length = 152 Score = 37.5 bits (83), Expect = 0.014 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = +2 Query: 719 KALKAQRKVVXGXHGKRVRKIXXSVHFRRPKTFEPPXHPKYP 844 +ALK + V G ++ +KI SV F RPKT + PKYP Sbjct: 16 QALKVAKAVKSGSIKRKSKKIRTSVTFHRPKTLKKARDPKYP 57 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,875,896 Number of Sequences: 37544 Number of extensions: 131700 Number of successful extensions: 264 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 259 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 264 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2495239620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -