BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_D18 (887 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ450529-1|ABE27283.1| 277|Drosophila melanogaster L23A ribosom... 52 1e-06 BT029645-1|ABL75704.1| 269|Drosophila melanogaster IP17216p pro... 52 1e-06 AE014296-329|AAF47545.1| 277|Drosophila melanogaster CG7977-PA ... 52 1e-06 AF080130-1|AAD19340.1| 269|Drosophila melanogaster ribosomal pr... 46 9e-05 >DQ450529-1|ABE27283.1| 277|Drosophila melanogaster L23A ribosomal protein naturalvariant protein. Length = 277 Score = 52.0 bits (119), Expect = 1e-06 Identities = 22/41 (53%), Positives = 27/41 (65%) Frame = +2 Query: 722 ALKAQRKVVXGXHGKRVRKIXXSVHFRRPKTFEPPXHPKYP 844 A K Q+K++ G G R RKI +VHFRRP T + P PKYP Sbjct: 142 AKKVQKKIIKGAFGTRARKIRANVHFRRPTTLKLPRSPKYP 182 >BT029645-1|ABL75704.1| 269|Drosophila melanogaster IP17216p protein. Length = 269 Score = 52.0 bits (119), Expect = 1e-06 Identities = 22/41 (53%), Positives = 27/41 (65%) Frame = +2 Query: 722 ALKAQRKVVXGXHGKRVRKIXXSVHFRRPKTFEPPXHPKYP 844 A K Q+K++ G G R RKI +VHFRRP T + P PKYP Sbjct: 134 AKKVQKKIIKGAFGTRARKIRTNVHFRRPTTLKLPRSPKYP 174 >AE014296-329|AAF47545.1| 277|Drosophila melanogaster CG7977-PA protein. Length = 277 Score = 52.0 bits (119), Expect = 1e-06 Identities = 22/41 (53%), Positives = 27/41 (65%) Frame = +2 Query: 722 ALKAQRKVVXGXHGKRVRKIXXSVHFRRPKTFEPPXHPKYP 844 A K Q+K++ G G R RKI +VHFRRP T + P PKYP Sbjct: 142 AKKVQKKIIKGAFGTRARKIRTNVHFRRPTTLKLPRSPKYP 182 >AF080130-1|AAD19340.1| 269|Drosophila melanogaster ribosomal protein L23a protein. Length = 269 Score = 45.6 bits (103), Expect = 9e-05 Identities = 21/41 (51%), Positives = 26/41 (63%) Frame = +2 Query: 722 ALKAQRKVVXGXHGKRVRKIXXSVHFRRPKTFEPPXHPKYP 844 A K Q+K++ G R RKI +VHFRRP T + P PKYP Sbjct: 135 AKKVQKKIIKAF-GTRARKIRTNVHFRRPTTLKLPRSPKYP 174 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,742,238 Number of Sequences: 53049 Number of extensions: 224440 Number of successful extensions: 404 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 401 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 404 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 4332305172 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -