BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_D18 (887 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U40948-2|AAA81728.1| 147|Caenorhabditis elegans Ribosomal prote... 40 0.003 Z75541-4|CAA99858.1| 146|Caenorhabditis elegans Hypothetical pr... 38 0.010 >U40948-2|AAA81728.1| 147|Caenorhabditis elegans Ribosomal protein, large subunitprotein 25.1 protein. Length = 147 Score = 39.5 bits (88), Expect = 0.003 Identities = 18/42 (42%), Positives = 25/42 (59%) Frame = +2 Query: 719 KALKAQRKVVXGXHGKRVRKIXXSVHFRRPKTFEPPXHPKYP 844 KAL A++KVV G R++ SVHFRRP T + ++P Sbjct: 11 KALDAKKKVVKGKRTTHRRQVRTSVHFRRPVTLKTARQARFP 52 >Z75541-4|CAA99858.1| 146|Caenorhabditis elegans Hypothetical protein F52B5.6 protein. Length = 146 Score = 37.9 bits (84), Expect = 0.010 Identities = 18/43 (41%), Positives = 25/43 (58%) Frame = +2 Query: 713 VTKALKAQRKVVXGXHGKRVRKIXXSVHFRRPKTFEPPXHPKY 841 V KA++A++ VV G + + SVHFRRPKT P+Y Sbjct: 8 VGKAIQAKKAVVKGSKTNVRKNVRTSVHFRRPKTLVTARAPRY 50 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,103,569 Number of Sequences: 27780 Number of extensions: 116044 Number of successful extensions: 264 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 255 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 264 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2244863852 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -